F246028

General Info

Members Datasets Scaffolds Average Seq Length
165 115 146 189

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10036859|Ga0105247_100368592
Length 211
Sequence MPTRLMIIVGSVRPGRIGLPIATWVRERAEANGGFDIDFVDLAELNLPFMDEPHHPRLRRYTKPHTIAWSERVAAADAFLFVTPEYNHSFSPALKNAYDFLNNEWWRKPIGYVSYGGVSGGTRGVVALDQAVTPLMVKVGANVEINFAGGRVVDGVFVPNEKESALIEKELDELIELSEVLKPSRLAGEPISAGLGRDRFGVGERAGVASA

Samples

Sample ID Description Type Environment
1 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
2 2643221572 Leifsonia sp. Root60 Isolate Unclassified
3 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
4 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
5 2643221688 Rhizobium sp. Root482 Isolate Unclassified
6 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
7 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
8 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
9 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
10 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
11 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
12 2842694124 Methylopila sp. R-72369 Isolate Unclassified
13 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
14 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
15 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
16 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
17 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
18 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
81 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
82 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
83 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
88 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
89 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
95 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
96 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
97 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
107 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
108 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
109 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
110 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
111 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
112 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
113 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
114 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
115 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.48
Metatranscriptomes 0
Isolates 11.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.12
Nodule 0
Rhizoplane 4.85
Rhizosphere 65.45
Stem 0
Stem Tuber 0
Unclassified 17.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10160244 3300005293 Bacteria 1636
2 Ga0070690_100504064 3300005330 Bacteria 906
3 Ga0070682_100363699 3300005337 Bacteria 1083
4 Ga0070682_100480946 3300005337 Bacteria 958
5 Ga0068868_100072727 3300005338 Bacteria 2743
6 Ga0070660_100048655 3300005339 Bacteria 3256
7 Ga0070659_100001471 3300005366 Bacteria 16957
8 Ga0070667_100007162 3300005367 Bacteria 9269
9 Ga0070694_100083575 3300005444 Bacteria 2225
10 Ga0070679_100067677 3300005530 Bacteria 3561
11 Ga0068853_100074559 3300005539 Bacteria 2960
12 Ga0068853_101205559 3300005539 Bacteria 731
13 Ga0068855_100007513 3300005563 Bacteria 13195
14 Ga0068855_100461623 3300005563 Bacteria 1385
15 Ga0068857_100020585 3300005577 Bacteria 5805
16 Ga0068857_100165583 3300005577 Bacteria 2007
17 Ga0068854_100855087 3300005578 Bacteria 797
18 Ga0068856_100053787 3300005614 Bacteria 3970
19 Ga0068856_100132587 3300005614 Bacteria 2496
20 Ga0068856_100818959 3300005614 Bacteria 950
21 Ga0068852_100129633 3300005616 Bacteria 2321
22 Ga0068859_100043378 3300005617 Bacteria 4520
23 Ga0068851_10000025 3300005834 Bacteria 123782
24 Ga0068863_100311635 3300005841 Bacteria 1528
25 Ga0068858_100000080 3300005842 Bacteria 100656
26 Ga0097620_100043378 3300006931 Bacteria 4520
27 Ga0105240_10014718 3300009093 Bacteria 10671
28 Ga0105240_10281628 3300009093 Bacteria 1909
29 Ga0105240_10448893 3300009093 Bacteria 1443
30 Ga0105247_10036859 3300009101 Bacteria 2981
31 Ga0105243_10760057 3300009148 Bacteria 951
32 Ga0105241_10010520 3300009174 Bacteria 6788
33 Ga0105241_10086317 3300009174 Bacteria 2468
34 Ga0105248_10016692 3300009177 Bacteria 8082
35 Ga0105248_10031961 3300009177 Bacteria 5881
36 Ga0105237_10002594 3300009545 Bacteria 22294
37 Ga0105237_10007443 3300009545 Bacteria 11979
38 Ga0105237_10074239 3300009545 Bacteria 3393
39 Ga0105238_10066108 3300009551 Bacteria 3617
40 Ga0105239_10165340 3300010375 Bacteria 2474
41 Ga0105239_10532656 3300010375 Bacteria 1337
42 Ga0105246_10636356 3300011119 Bacteria 927
43 Ga0157370_10092932 3300013104 Bacteria 2831
44 Ga0157374_10667656 3300013296 Bacteria 1052
45 Ga0163163_10223678 3300014325 Bacteria 1931
46 Ga0157377_10001177 3300014745 Bacteria 11110
47 Ga0157379_10020000 3300014968 Bacteria 5917
48 Ga0157376_10701926 3300014969 Bacteria 1017
49 Ga0209148_1003081 3300025254 Bacteria 4890
50 Ga0207656_10000001 3300025321 Bacteria 1323684
51 Ga0207656_10000003 3300025321 Bacteria 771644
52 Ga0207656_10000004 3300025321 Bacteria 632320
53 Ga0207705_10023735 3300025909 Bacteria 4376
54 Ga0207654_10000003 3300025911 Bacteria 1030378
55 Ga0207654_10105019 3300025911 Bacteria 1747
56 Ga0207695_10009643 3300025913 Bacteria 11905
57 Ga0207695_10017024 3300025913 Bacteria 8477
58 Ga0207695_10421163 3300025913 Bacteria 1219
59 Ga0207671_10000001 3300025914 Bacteria 1318881
60 Ga0207671_10056428 3300025914 Bacteria 2910
61 Ga0207657_10015762 3300025919 Bacteria 7306
62 Ga0207652_10020255 3300025921 Bacteria 5476
63 Ga0207652_10632446 3300025921 Bacteria 958
64 Ga0207694_10000047 3300025924 Bacteria 163953
65 Ga0207694_10118601 3300025924 Bacteria 2111
66 Ga0207687_10020730 3300025927 Bacteria 4361
67 Ga0207687_10109095 3300025927 Bacteria 2050
68 Ga0207664_10266768 3300025929 Bacteria 1499
69 Ga0207690_10002473 3300025932 Bacteria 11166
70 Ga0207706_10197900 3300025933 Bacteria 1762
71 Ga0207709_10102220 3300025935 Bacteria 1897
72 Ga0207711_10000840 3300025941 Bacteria 29678
73 Ga0207711_10040362 3300025941 Bacteria 3970
74 Ga0207667_10001544 3300025949 Bacteria 28956
75 Ga0207667_10003137 3300025949 Bacteria 20458
76 Ga0207667_10109166 3300025949 Bacteria 2854
77 Ga0207667_10311102 3300025949 Bacteria 1609
78 Ga0207667_10518926 3300025949 Bacteria 1207
79 Ga0207658_10004130 3300025986 Bacteria 10126
80 Ga0207677_10077411 3300026023 Bacteria 2372
81 Ga0207703_10000033 3300026035 Bacteria 187752
82 Ga0207639_10017835 3300026041 Bacteria 5034
83 Ga0207702_10180212 3300026078 Bacteria 1945
84 Ga0207702_10438837 3300026078 Bacteria 1265
85 Ga0207702_10541612 3300026078 Bacteria 1138
86 Ga0207676_10420761 3300026095 Bacteria 1253
87 Ga0207674_10002321 3300026116 Bacteria 24095
88 Ga0207674_10156852 3300026116 Bacteria 2231
89 Ga0207674_10184612 3300026116 Bacteria 2036
90 Ga0207698_10004131 3300026142 Bacteria 8821
91 Ga0207698_10010566 3300026142 Bacteria 5942
92 Ga0307514_10009442 3300031649 Bacteria 8209
93 Ga0307405_10784828 3300031731 Bacteria 797
94 Ga0451793_0824703 3300041452 Bacteria 2109
95 Ga0451793_1000093 3300041452 Bacteria 1043
96 Ga0451797_0824989 3300041453 Bacteria 1511
97 Ga0451795_0969312 3300041456 Bacteria 875
98 Ga0451833_1337716 3300041491 Bacteria 758
99 Ga0453684_0119210 3300044712 Bacteria 3190
100 Ga0466960_0233027 3300044901 Bacteria 1017
101 Ga0495603_0072640 3300046455 Bacteria 2021
102 Ga0495650_0004731 3300046471 Bacteria 9158
103 Ga0495633_0246048 3300046558 Bacteria 816
104 Ga0495659_0105712 3300046664 Bacteria 1094
105 Ga0495658_0609449 3300046683 Unclassified 699
106 Ga0495686_0093039 3300047472 Bacteria 1828
107 Ga0496107_0870915 3300048910 Bacteria 657
108 Ga0496115_0000969 3300048918 Bacteria 20841
109 Ga0496117_0000034 3300048920 Bacteria 328334
110 Ga0496117_0183050 3300048920 Bacteria 1202
111 Ga0496118_0068567 3300048921 Bacteria 2575
112 Ga0496119_0001411 3300048922 Bacteria 29079
113 Ga0496119_0004213 3300048922 Bacteria 14443
114 Ga0496119_0040424 3300048922 Bacteria 2983
115 Ga0496119_0052449 3300048922 Bacteria 2498
116 Ga0496120_0001118 3300048923 Bacteria 34774
117 Ga0496120_0014490 3300048923 Bacteria 5253
118 Ga0496120_0025449 3300048923 Bacteria 3672
119 Ga0496120_0175691 3300048923 Bacteria 1056
120 Ga0496121_0000098 3300048924 Bacteria 200516
121 Ga0496125_0333308 3300048928 Bacteria 914
122 Ga0496126_0017125 3300048929 Bacteria 7227
123 Ga0501037_0041497 3300049573 Bacteria 3384
124 Ga0501042_0649184 3300049578 Bacteria 767
125 Ga0501047_0725540 3300049581 Bacteria 810
126 Ga0501035_0003718 3300049822 Bacteria 14548
127 Ga0501044_0006190 3300049823 Bacteria 13226
128 Ga0500651_0000206 3300053093 Bacteria 37111
129 Ga0500556_0000028 3300053104 Bacteria 165503
130 Ga0500621_064176 3300053126 Bacteria 1484
131 Ga0500655_034475 3300053133 Bacteria 982
132 Ga0500559_0000052 3300053136 Bacteria 91218
133 Ga0500559_0011711 3300053136 Bacteria 3740
134 Ga0500559_0028670 3300053136 Bacteria 2380
135 Ga0500559_0153388 3300053136 Bacteria 1081
136 Ga0500559_0163529 3300053136 Bacteria 1046
137 Ga0500568_0000009 3300053139 Bacteria 270298
138 Ga0500573_0000031 3300053140 Bacteria 134098
139 Ga0500573_0000108 3300053140 Bacteria 34375
140 Ga0500573_0022413 3300053140 Bacteria 3624
141 Ga0500573_0092309 3300053140 Bacteria 1709
142 Ga0500573_0117452 3300053140 Bacteria 1483
143 Ga0500573_0165635 3300053140 Bacteria 1200
144 Ga0500573_0279613 3300053140 Bacteria 845
145 Ga0500590_009428 3300053148 Bacteria 4910
146 Ga0500620_000156 3300053155 Bacteria 13695

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025929 Ga0207664_10266768 Ga0207664_102667682 180
2 3300041452 Ga0451793_1000093 Ga0451793_1000093_191_736 181
3 3300041453 Ga0451797_0824989 Ga0451797_0824989_707_1252 181
4 3300044901 Ga0466960_0233027 Ga0466960_0233027_209_754 181
5 3300053126 Ga0500621_064176 Ga0500621_064176_12_557 181
6 3300053136 Ga0500559_0163529 Ga0500559_0163529_213_758 181
7 3300053140 Ga0500573_0000031 Ga0500573_0000031_99022_99567 181
8 3300053140 Ga0500573_0022413 Ga0500573_0022413_2532_3077 181
9 3300053140 Ga0500573_0092309 Ga0500573_0092309_689_1234 181
10 3300053140 Ga0500573_0117452 Ga0500573_0117452_377_925 181
11 iso_pu_bacteria 2643221572 2643877214 181
12 iso_pu_bacteria 2643221669 2644384269 181
13 iso_pu_bacteria 2895660088 2895661982 181
14 3300013296 Ga0157374_10667656 Ga0157374_106676562 182
15 3300014325 Ga0163163_10223678 Ga0163163_102236781 182
16 3300041456 Ga0451795_0969312 Ga0451795_0969312_234_782 182
17 3300048921 Ga0496118_0068567 Ga0496118_0068567_2010_2561 182
18 3300048922 Ga0496119_0001411 Ga0496119_0001411_16569_17120 182
19 3300048922 Ga0496119_0040424 Ga0496119_0040424_692_1243 182
20 3300048923 Ga0496120_0001118 Ga0496120_0001118_1336_1887 182
21 3300048923 Ga0496120_0014490 Ga0496120_0014490_4594_5145 182
22 3300048928 Ga0496125_0333308 Ga0496125_0333308_26_577 182
23 3300046471 Ga0495650_0004731 Ga0495650_0004731_4141_4695 183
24 3300046558 Ga0495633_0246048 Ga0495633_0246048_193_759 183
25 3300048922 Ga0496119_0052449 Ga0496119_0052449_1577_2128 183
26 3300053093 Ga0500651_0000206 Ga0500651_0000206_18351_18905 183
27 3300053136 Ga0500559_0000052 Ga0500559_0000052_17558_18160 183
28 3300053136 Ga0500559_0028670 Ga0500559_0028670_1788_2345 183
29 3300053140 Ga0500573_0165635 Ga0500573_0165635_31_588 183
30 3300053148 Ga0500590_009428 Ga0500590_009428_790_1344 183
31 3300053155 Ga0500620_000156 Ga0500620_000156_5032_5586 183
32 iso_pu_bacteria 2767802442 2770195346 183
33 iso_pu_bacteria 2840764183 2840767504 183
34 iso_pu_bacteria 2894652903 2894656078 183
35 3300047472 Ga0495686_0093039 Ga0495686_0093039_1046_1603 184
36 3300048910 Ga0496107_0870915 Ga0496107_0870915_89_643 184
37 3300048918 Ga0496115_0000969 Ga0496115_0000969_943_1509 184
38 3300048922 Ga0496119_0004213 Ga0496119_0004213_9960_10514 184
39 3300048923 Ga0496120_0025449 Ga0496120_0025449_1372_1926 184
40 3300048924 Ga0496121_0000098 Ga0496121_0000098_48090_48644 184
41 3300048929 Ga0496126_0017125 Ga0496126_0017125_2739_3302 184
42 3300053104 Ga0500556_0000028 Ga0500556_0000028_122796_123353 184
43 3300053133 Ga0500655_034475 Ga0500655_034475_316_873 184
44 3300053139 Ga0500568_0000009 Ga0500568_0000009_115981_116538 184
45 3300053140 Ga0500573_0279613 Ga0500573_0279613_99_656 184
46 iso_pu_bacteria 2511231027 2511389759 184
47 iso_pu_bacteria 2643221635 2644198078 184
48 iso_pu_bacteria 2643221688 2644496576 184
49 iso_pu_bacteria 2765235802 2765464732 184
50 iso_pu_bacteria 2775506902 2776270706 184
51 iso_pu_bacteria 2775506904 2776280471 184
52 iso_pu_bacteria 2839993093 2839996919 184
53 iso_pu_bacteria 2842694124 2842695294 184
54 iso_pu_bacteria 2842871566 2842871856 184
55 iso_pu_bacteria 2842922631 2842926661 184
56 iso_pu_bacteria 2857531043 2857533157 184
57 iso_pu_bacteria 8055909800 8055912056 184
58 3300005338 Ga0068868_100072727 Ga0068868_1000727273 185
59 3300005339 Ga0070660_100048655 Ga0070660_1000486552 185
60 3300005366 Ga0070659_100001471 Ga0070659_1000014714 185
61 3300005367 Ga0070667_100007162 Ga0070667_10000716212 185
62 3300005444 Ga0070694_100083575 Ga0070694_1000835752 185
63 3300005539 Ga0068853_100074559 Ga0068853_1000745592 185
64 3300005539 Ga0068853_101205559 Ga0068853_1012055591 185
65 3300005577 Ga0068857_100020585 Ga0068857_1000205852 185
66 3300005577 Ga0068857_100165583 Ga0068857_1001655832 185
67 3300005578 Ga0068854_100855087 Ga0068854_1008550872 185
68 3300005614 Ga0068856_100053787 Ga0068856_1000537873 185
69 3300005614 Ga0068856_100818959 Ga0068856_1008189592 185
70 3300005616 Ga0068852_100129633 Ga0068852_1001296333 185
71 3300005617 Ga0068859_100043378 Ga0068859_1000433781 185
72 3300005834 Ga0068851_10000025 Ga0068851_100000252 185
73 3300005841 Ga0068863_100311635 Ga0068863_1003116352 185
74 3300005842 Ga0068858_100000080 Ga0068858_1000000803 185
75 3300006931 Ga0097620_100043378 Ga0097620_1000433781 185
76 3300009093 Ga0105240_10014718 Ga0105240_1001471813 185
77 3300009093 Ga0105240_10281628 Ga0105240_102816282 185
78 3300009101 Ga0105247_10036859 Ga0105247_100368592 185
79 3300009148 Ga0105243_10760057 Ga0105243_107600571 185
80 3300009174 Ga0105241_10010520 Ga0105241_100105203 185
81 3300009174 Ga0105241_10086317 Ga0105241_100863171 185
82 3300009177 Ga0105248_10016692 Ga0105248_100166922 185
83 3300009177 Ga0105248_10031961 Ga0105248_100319615 185
84 3300009545 Ga0105237_10002594 Ga0105237_1000259423 185
85 3300009545 Ga0105237_10007443 Ga0105237_1000744314 185
86 3300009545 Ga0105237_10074239 Ga0105237_100742392 185
87 3300009551 Ga0105238_10066108 Ga0105238_100661083 185
88 3300010375 Ga0105239_10165340 Ga0105239_101653402 185
89 3300011119 Ga0105246_10636356 Ga0105246_106363562 185
90 3300013104 Ga0157370_10092932 Ga0157370_100929321 185
91 3300014745 Ga0157377_10001177 Ga0157377_100011774 185
92 3300014968 Ga0157379_10020000 Ga0157379_100200002 185
93 3300014969 Ga0157376_10701926 Ga0157376_107019262 185
94 3300025254 Ga0209148_1003081 Ga0209148_10030813 185
95 3300025321 Ga0207656_10000001 Ga0207656_10000001623 185
96 3300025321 Ga0207656_10000003 Ga0207656_10000003729 185
97 3300025321 Ga0207656_10000004 Ga0207656_10000004586 185
98 3300025909 Ga0207705_10023735 Ga0207705_100237353 185
99 3300025911 Ga0207654_10000003 Ga0207654_10000003913 185
100 3300025911 Ga0207654_10105019 Ga0207654_101050191 185
101 3300025913 Ga0207695_10009643 Ga0207695_100096434 185
102 3300025913 Ga0207695_10017024 Ga0207695_100170245 185
103 3300025914 Ga0207671_10000001 Ga0207671_10000001621 185
104 3300025914 Ga0207671_10056428 Ga0207671_100564282 185
105 3300025919 Ga0207657_10015762 Ga0207657_100157626 185
106 3300025921 Ga0207652_10632446 Ga0207652_106324462 185
107 3300025924 Ga0207694_10000047 Ga0207694_1000004765 185
108 3300025924 Ga0207694_10118601 Ga0207694_101186012 185
109 3300025927 Ga0207687_10020730 Ga0207687_100207302 185
110 3300025927 Ga0207687_10109095 Ga0207687_101090952 185
111 3300025932 Ga0207690_10002473 Ga0207690_100024734 185
112 3300025935 Ga0207709_10102220 Ga0207709_101022202 185
113 3300025941 Ga0207711_10000840 Ga0207711_100008403 185
114 3300025941 Ga0207711_10040362 Ga0207711_100403623 185
115 3300025949 Ga0207667_10001544 Ga0207667_100015444 185
116 3300025949 Ga0207667_10311102 Ga0207667_103111021 185
117 3300025986 Ga0207658_10004130 Ga0207658_100041308 185
118 3300026023 Ga0207677_10077411 Ga0207677_100774112 185
119 3300026035 Ga0207703_10000033 Ga0207703_10000033146 185
120 3300026041 Ga0207639_10017835 Ga0207639_100178353 185
121 3300026078 Ga0207702_10438837 Ga0207702_104388372 185
122 3300026095 Ga0207676_10420761 Ga0207676_104207612 185
123 3300026116 Ga0207674_10002321 Ga0207674_100023219 185
124 3300026116 Ga0207674_10156852 Ga0207674_101568522 185
125 3300026116 Ga0207674_10184612 Ga0207674_101846122 185
126 3300026142 Ga0207698_10004131 Ga0207698_100041312 185
127 3300026142 Ga0207698_10010566 Ga0207698_100105665 185
128 3300041491 Ga0451833_1337716 Ga0451833_1337716_58_624 185
129 3300046455 Ga0495603_0072640 Ga0495603_0072640_546_1106 185
130 3300046664 Ga0495659_0105712 Ga0495659_0105712_148_708 185
131 3300046683 Ga0495658_0609449 Ga0495658_0609449_33_614 185
132 3300048920 Ga0496117_0183050 Ga0496117_0183050_271_906 185
133 3300048923 Ga0496120_0175691 Ga0496120_0175691_151_711 185
134 3300053140 Ga0500573_0000108 Ga0500573_0000108_2317_2886 185
135 3300005293 Ga0065715_10160244 Ga0065715_101602442 186
136 3300005330 Ga0070690_100504064 Ga0070690_1005040642 186
137 3300005337 Ga0070682_100363699 Ga0070682_1003636992 186
138 3300005337 Ga0070682_100480946 Ga0070682_1004809461 186
139 3300005530 Ga0070679_100067677 Ga0070679_1000676773 186
140 3300005563 Ga0068855_100007513 Ga0068855_1000075132 186
141 3300005563 Ga0068855_100461623 Ga0068855_1004616232 186
142 3300005614 Ga0068856_100132587 Ga0068856_1001325872 186
143 3300009093 Ga0105240_10448893 Ga0105240_104488932 186
144 3300010375 Ga0105239_10532656 Ga0105239_105326562 186
145 3300025913 Ga0207695_10421163 Ga0207695_104211632 186
146 3300025921 Ga0207652_10020255 Ga0207652_100202553 186
147 3300025933 Ga0207706_10197900 Ga0207706_101979002 186
148 3300025949 Ga0207667_10003137 Ga0207667_100031372 186
149 3300025949 Ga0207667_10109166 Ga0207667_101091662 186
150 3300025949 Ga0207667_10518926 Ga0207667_105189262 186
151 3300026078 Ga0207702_10180212 Ga0207702_101802123 186
152 3300026078 Ga0207702_10541612 Ga0207702_105416122 186
153 3300031649 Ga0307514_10009442 Ga0307514_1000944210 186
154 3300031731 Ga0307405_10784828 Ga0307405_107848281 186
155 3300041452 Ga0451793_0824703 Ga0451793_0824703_1421_1987 186
156 3300044712 Ga0453684_0119210 Ga0453684_0119210_1408_2019 186
157 3300048920 Ga0496117_0000034 Ga0496117_0000034_245007_245597 186
158 3300049573 Ga0501037_0041497 Ga0501037_0041497_1810_2415 186
159 3300049578 Ga0501042_0649184 Ga0501042_0649184_80_685 186
160 3300049581 Ga0501047_0725540 Ga0501047_0725540_172_777 186
161 3300049822 Ga0501035_0003718 Ga0501035_0003718_9036_9641 186
162 3300049823 Ga0501044_0006190 Ga0501044_0006190_51_656 186
163 3300053136 Ga0500559_0011711 Ga0500559_0011711_2004_2573 186
164 3300053136 Ga0500559_0153388 Ga0500559_0153388_64_633 186
165 iso_pu_bacteria 2939660829 2939663078 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

3

150

0.91

PF02525

Flavodoxin_2

Flavodoxin-like fold

3

131

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bx9-assembly1.cif.gz_A purification, characterization and x-ray structure of yhda-type azoreductase from bacillus velezensis 0.8603 3 176
2fzv-assembly1.cif.gz_C crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.8407 1 184
7f76-assembly1.cif.gz_A crystal structure of fmn-dependent nadph-quinone reductase (azor) from bacillus cohnii 0.8402 1 181
3gfq-assembly1.cif.gz_A structure of yhda, k109l variant 0.8397 4 179
2q62-assembly1.cif.gz_D crystal structure of arsh from sinorhizobium meliloti 0.8377 2 185
ID Description Score Start End Superfamily
af_Q54QT4_9_187_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9065 3 167 3.40.50.360
af_Q9USJ6_13_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8895 2 164 3.40.50.360
af_Q2G135_1_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8727 1 181 3.40.50.360
af_Q9USJ6_13_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8691 2 164 3.40.50.360
af_Q2G135_1_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8637 1 181 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A2T2WGI2-F1-model_v4 NADPH-dependent FMN reductase 0.9947 2 185 GO:0005829
GO:0010181
GO:0016491
AF-A0A2Y8ZTV3-F1-model_v4 NAD(P)H-dependent FMN reductase 0.9945 2 184 GO:0005829
GO:0010181
GO:0016491
AF-A0A443KA64-F1-model_v4 NADPH-dependent oxidoreductase 0.9941 1 183 GO:0005829
GO:0010181
GO:0016491
AF-A0A5N6C5U6-F1-model_v4 NADPH-dependent FMN reductase 0.994 2 184 GO:0005829
GO:0010181
GO:0016491
AF-A0A5D0VET9-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9935 1 183 GO:0005829
GO:0010181
GO:0016491

Feature Viewer

pLDDT pTM Quality
95.77 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map