F245749

General Info

Members Datasets Scaffolds Average Seq Length
165 126 157 215

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100116899|Ga0068862_1001168992
Length 226
Sequence MVVRLPHALLIGATGATGKDLLDLLLKDDDFHRVDIFVRREVASNHEKLNVHVIDFDKPDQWKHLVKGDVLFSCLGTTLKAAGSKEAQWKIDYDXXXXFAKAARENGVDNYVLVSSSGASPDSFLFYPRMKGQLEDAVKSLGFAKLSIFNPPILERKNTDRTGEVIGLKVIRFLNRFGLFRSQKPMPTEILARAMMNSARAGENGIQIYKGEAIWKCAEDHIRESE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
3 2739367656 Pedobacter sp. CF523 Isolate Unclassified
4 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
5 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
6 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
7 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
8 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
9 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
95 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
96 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
97 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
98 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
99 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
100 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
101 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
104 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
108 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
109 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
110 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
111 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
112 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
113 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
117 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
118 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
119 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
120 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
121 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
122 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
123 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
124 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
125 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
126 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.94
Metatranscriptomes 0.61
Isolates 5.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.88
Nodule 0
Rhizoplane 0
Rhizosphere 79.39
Stem 0
Stem Tuber 0
Unclassified 12.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1556754 2162886007 Bacteria 16121
2 JGI24740J21852_10000062 3300001979 Bacteria 34499
3 rootH1_10078970 3300003316 Unclassified 3250
4 rootH1_10078970 3300003323 Bacteria 3824
5 rootH1_10126855 3300003316 Unclassified 2361
6 rootH2_10314719 3300003320 Bacteria 1811
7 rootL2_10062044 3300003322 Bacteria 7400
8 rootL2_10197639 3300003322 Bacteria 1936
9 rootL2_10329121 3300003322 Bacteria 6097
10 rootH1_10310789 3300003323 Bacteria 1464
11 Ga0065165_1000857 3300005262 Bacteria 39843
12 Ga0065714_10002529 3300005288 Bacteria 16048
13 Ga0065704_10070217 3300005289 Bacteria 69033
14 Ga0065712_10102513 3300005290 Unclassified 2007
15 Ga0070658_10088683 3300005327 Bacteria 2547
16 Ga0070676_10137463 3300005328 Unclassified 1552
17 Ga0070683_100024534 3300005329 Bacteria 5403
18 Ga0070670_100028202 3300005331 Bacteria 4832
19 Ga0070670_100357870 3300005331 Bacteria 1283
20 Ga0070670_100452839 3300005331 Bacteria 1138
21 Ga0068869_100112630 3300005334 Bacteria 2071
22 Ga0070661_100021753 3300005344 Bacteria 4586
23 Ga0070668_100042589 3300005347 Bacteria 3480
24 Ga0070675_100179381 3300005354 Bacteria 1830
25 Ga0070671_100135021 3300005355 Bacteria 2080
26 Ga0070671_100151644 3300005355 Bacteria 1957
27 Ga0070667_100154695 3300005367 Bacteria 2016
28 Ga0070667_100295581 3300005367 Bacteria 1457
29 Ga0068867_100185558 3300005459 Unclassified 1656
30 Ga0070685_10272884 3300005466 Bacteria 1129
31 Ga0070684_100004933 3300005535 Bacteria 10180
32 Ga0068853_100335333 3300005539 Bacteria 1404
33 Ga0068853_100358886 3300005539 Bacteria 1357
34 Ga0068853_100558013 3300005539 Bacteria 1085
35 Ga0070665_100000047 3300005548 Bacteria 269702
36 Ga0070664_100023878 3300005564 Bacteria 5051
37 Ga0068854_100817769 3300005578 Unclassified 813
38 Ga0068852_100149857 3300005616 Bacteria 2168
39 Ga0068852_100311708 3300005616 Bacteria 1526
40 Ga0068859_100943519 3300005617 Bacteria 946
41 Ga0068864_100241755 3300005618 Bacteria 1673
42 Ga0068864_100290049 3300005618 Bacteria 1529
43 Ga0068861_100017609 3300005719 Bacteria 5076
44 Ga0068863_100108987 3300005841 Bacteria 2636
45 Ga0068860_100009597 3300005843 Bacteria 9617
46 Ga0068862_100116899 3300005844 Bacteria 2347
47 Ga0068862_100638218 3300005844 Unclassified 1026
48 Ga0097620_100943469 3300006931 Bacteria 946
49 Ga0111539_10358586 3300009094 Bacteria 1697
50 Ga0111539_10799778 3300009094 Bacteria 1097
51 Ga0114129_11309160 3300009147 Unclassified 898
52 Ga0105241_10714987 3300009174 Bacteria 916
53 Ga0105242_10203144 3300009176 Bacteria 1761
54 Ga0105237_10009227 3300009545 Bacteria 10585
55 Ga0105249_10010023 3300009553 Bacteria 8315
56 Ga0105249_10850730 3300009553 Bacteria 978
57 Ga0157373_10000440 3300013100 Bacteria 32951
58 Ga0157371_10001163 3300013102 Bacteria 28264
59 Ga0157371_10009786 3300013102 Bacteria 7517
60 Ga0157371_10394054 3300013102 Bacteria 1012
61 Ga0157370_10021998 3300013104 Bacteria 6350
62 Ga0157370_10050090 3300013104 Bacteria 3994
63 Ga0157370_10221603 3300013104 Unclassified 1752
64 Ga0157369_10001340 3300013105 Bacteria 30410
65 Ga0157374_10314401 3300013296 Bacteria 1551
66 Ga0157374_10995037 3300013296 Bacteria 857
67 Ga0163162_10000704 3300013306 Bacteria 30930
68 Ga0157372_10208699 3300013307 Unclassified 2263
69 Ga0157372_10284780 3300013307 Bacteria 1922
70 Ga0163163_10000557 3300014325 Bacteria 32741
71 Ga0163163_10652098 3300014325 Bacteria 1116
72 Ga0157380_10831026 3300014326 Bacteria 944
73 Ga0182008_10000049 3300014497 Bacteria 105068
74 Ga0157377_10099463 3300014745 Bacteria 1730
75 Ga0157379_10320194 3300014968 Bacteria 1416
76 Ga0182006_1000999 3300015261 Bacteria 18510
77 Ga0163161_10000189 3300017792 Bacteria 56683
78 Ga0209676_1001309 3300025292 Bacteria 25307
79 Ga0209050_1000630 3300025298 Bacteria 54802
80 Ga0207671_10056624 3300025914 Bacteria 2905
81 Ga0207649_10118229 3300025920 Bacteria 1783
82 Ga0207650_10003727 3300025925 Bacteria 10424
83 Ga0207650_10397594 3300025925 Bacteria 1140
84 Ga0207669_10101339 3300025937 Bacteria 1905
85 Ga0207689_10006265 3300025942 Bacteria 10543
86 Ga0207661_10173478 3300025944 Bacteria 1878
87 Ga0207679_10027658 3300025945 Bacteria 3925
88 Ga0207679_10058101 3300025945 Bacteria 2864
89 Ga0207712_10057466 3300025961 Bacteria 2745
90 Ga0207712_10110846 3300025961 Bacteria 2058
91 Ga0207712_10325536 3300025961 Bacteria 1270
92 Ga0207668_10233409 3300025972 Bacteria 1484
93 Ga0207668_10831126 3300025972 Bacteria 819
94 Ga0207640_10654155 3300025981 Unclassified 896
95 Ga0207658_10253626 3300025986 Unclassified 1496
96 Ga0207678_10477173 3300026067 Bacteria 1086
97 Ga0207641_10094181 3300026088 Bacteria 2626
98 Ga0207648_10140361 3300026089 Unclassified 2129
99 Ga0207676_10511769 3300026095 Bacteria 1141
100 Ga0207675_100013003 3300026118 Bacteria 7769
101 Ga0207675_100826864 3300026118 Unclassified 940
102 Ga0207698_10129772 3300026142 Bacteria 2151
103 Ga0268266_10000104 3300028379 Bacteria 178320
104 Ga0268265_10053316 3300028380 Bacteria 3064
105 Ga0268265_10106534 3300028380 Bacteria 2277
106 Ga0268265_10515880 3300028380 Unclassified 1129
107 Ga0268264_10000028 3300028381 Bacteria 426662
108 Ga0268264_10005886 3300028381 Bacteria 10375
109 Ga0268264_10310435 3300028381 Unclassified 1488
110 Ga0307515_10000261 3300028794 Bacteria 130891
111 Ga0307406_10000026 3300031901 Bacteria 92099
112 Ga0307412_10025183 3300031911 Bacteria 3682
113 Ga0307409_100268219 3300031995 Bacteria 1570
114 Ga0307409_100547641 3300031995 Unclassified 1135
115 Ga0307414_10021401 3300032004 Unclassified 4057
116 Ga0307414_10176807 3300032004 Bacteria 1712
117 Ga0451853_0693312 3300041512 Bacteria 1076
118 Ga0451853_1086216 3300041512 Bacteria 1006
119 Ga0451577_0039474 3300042876 Bacteria 4243
120 Ga0453683_0151470 3300044673 Bacteria 1466
121 Ga0495627_011118 3300046453 Bacteria 3241
122 Ga0495638_0195279 3300046460 Unclassified 1146
123 Ga0495643_0004660 3300046522 Bacteria 9525
124 Ga0495643_0120968 3300046522 Bacteria 1323
125 Ga0495668_0000331 3300046616 Bacteria 64652
126 Ga0495668_0004116 3300046616 Bacteria 10534
127 Ga0495672_0018456 3300047320 Bacteria 4629
128 Ga0495686_0000125 3300047472 Bacteria 158834
129 Ga0496116_0000079 3300048919 Bacteria 226744
130 Ga0496117_0101939 3300048920 Bacteria 1813
131 Ga0496121_0019965 3300048924 Bacteria 6667
132 Ga0496124_0037362 3300048927 Bacteria 4224
133 Ga0496125_0001078 3300048928 Bacteria 42016
134 Ga0496126_0010175 3300048929 Bacteria 9898
135 Ga0496126_0014994 3300048929 Bacteria 7813
136 Ga0496126_0114825 3300048929 Bacteria 2342
137 Ga0501306_016555 3300049127 Bacteria 992
138 Ga0501198_008427 3300049649 Unclassified 1497
139 Ga0501198_035621 3300049649 Unclassified 846
140 Ga0501223_023486 3300049663 Bacteria 1202
141 Ga0501252_026767 3300049682 Unclassified 782
142 Ga0501259_001469 3300049688 Unclassified 3922
143 Ga0501245_001265 3300049708 Unclassified 3250
144 Ga0501266_001309 3300049763 Unclassified 3172
145 Ga0501268_000682 3300049765 Unclassified 3843
146 nmdc:mga05p37_1219878_c1 3300050507 Bacteria 775
147 nmdc:mga08y16_294045_c1 3300050511 Bacteria 1674
148 Ga0500644_0000580 3300053088 Bacteria 13994
149 Ga0500562_032170 3300053108 Bacteria 1384
150 Ga0500652_046114 3300053131 Bacteria 1768
151 Ga0500655_042959 3300053133 Unclassified 890
152 Ga0500559_0143618 3300053136 Bacteria 1118
153 Ga0500568_0018232 3300053139 Bacteria 3078
154 Ga0500616_0045321 3300053153 Bacteria 2343
155 Ga0500634_0060200 3300053161 Bacteria 2017
156 Ga0500611_000012 3300053727 Bacteria 137782
157 Ga0500645_073444 3300053730 Bacteria 980

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053133 Ga0500655_042959 Ga0500655_042959_40_618 192
2 3300009094 Ga0111539_10799778 Ga0111539_107997782 202
3 3300009147 Ga0114129_11309160 Ga0114129_113091601 202
4 3300050507 nmdc:mga05p37_1219878_c1 nmdc:mga05p37_1219878_c1_83_748 202
5 3300032004 Ga0307414_10176807 Ga0307414_101768071 204
6 3300005466 Ga0070685_10272884 Ga0070685_102728841 205
7 3300005618 Ga0068864_100290049 Ga0068864_1002900492 205
8 3300026095 Ga0207676_10511769 Ga0207676_105117692 205
9 3300013307 Ga0157372_10208699 Ga0157372_102086992 206
10 3300041512 Ga0451853_0693312 Ga0451853_0693312_339_992 206
11 3300049127 Ga0501306_016555 Ga0501306_016555_161_808 206
12 iso_pu_bacteria 2643221600 2644011328 208
13 iso_pu_bacteria 2739367656 2739614277 208
14 iso_pu_bacteria 2816332280 2817415936 208
15 iso_pu_bacteria 2903895155 2903896285 208
16 iso_pu_bacteria 2919191525 2919193908 208
17 iso_pu_bacteria 2945977869 2945978654 208
18 iso_pu_bacteria 2946013367 2946015480 208
19 iso_pu_bacteria 2965320100 2965321421 208
20 iso_pu_bacteria 8054307821 8054309679 208
21 3300001979 JGI24740J21852_10000062 JGI24740J21852_1000006224 212
22 3300003316 rootH1_10078970 rootH1_100789704 212
23 3300003316 rootH1_10126855 rootH1_101268553 212
24 3300003320 rootH2_10314719 rootH2_103147192 212
25 3300003322 rootL2_10062044 rootL2_100620445 212
26 3300003322 rootL2_10197639 rootL2_101976394 212
27 3300003322 rootL2_10329121 rootL2_103291217 212
28 3300003323 rootH1_10310789 rootH1_103107892 212
29 3300005262 Ga0065165_1000857 Ga0065165_100085713 212
30 3300005328 Ga0070676_10137463 Ga0070676_101374632 212
31 3300005331 Ga0070670_100452839 Ga0070670_1004528391 212
32 3300005334 Ga0068869_100112630 Ga0068869_1001126302 212
33 3300005347 Ga0070668_100042589 Ga0070668_1000425893 212
34 3300005367 Ga0070667_100295581 Ga0070667_1002955812 212
35 3300005459 Ga0068867_100185558 Ga0068867_1001855582 212
36 3300005539 Ga0068853_100335333 Ga0068853_1003353332 212
37 3300005539 Ga0068853_100358886 Ga0068853_1003588862 212
38 3300005539 Ga0068853_100558013 Ga0068853_1005580131 212
39 3300005548 Ga0070665_100000047 Ga0070665_100000047147 212
40 3300005578 Ga0068854_100817769 Ga0068854_1008177692 212
41 3300005616 Ga0068852_100149857 Ga0068852_1001498573 212
42 3300005616 Ga0068852_100311708 Ga0068852_1003117083 212
43 3300005617 Ga0068859_100943519 Ga0068859_1009435192 212
44 3300005618 Ga0068864_100241755 Ga0068864_1002417552 212
45 3300005719 Ga0068861_100017609 Ga0068861_1000176097 212
46 3300005841 Ga0068863_100108987 Ga0068863_1001089872 212
47 3300005843 Ga0068860_100009597 Ga0068860_1000095972 212
48 3300005844 Ga0068862_100638218 Ga0068862_1006382182 212
49 3300006931 Ga0097620_100943469 Ga0097620_1009434692 212
50 3300009094 Ga0111539_10358586 Ga0111539_103585861 212
51 3300009174 Ga0105241_10714987 Ga0105241_107149871 212
52 3300009176 Ga0105242_10203144 Ga0105242_102031442 212
53 3300009545 Ga0105237_10009227 Ga0105237_1000922710 212
54 3300009553 Ga0105249_10010023 Ga0105249_100100236 212
55 3300009553 Ga0105249_10850730 Ga0105249_108507302 212
56 3300013102 Ga0157371_10001163 Ga0157371_100011631 212
57 3300013102 Ga0157371_10009786 Ga0157371_100097863 212
58 3300013104 Ga0157370_10021998 Ga0157370_100219984 212
59 3300013104 Ga0157370_10050090 Ga0157370_100500904 212
60 3300013104 Ga0157370_10221603 Ga0157370_102216032 212
61 3300013105 Ga0157369_10001340 Ga0157369_1000134016 212
62 3300013296 Ga0157374_10995037 Ga0157374_109950372 212
63 3300013306 Ga0163162_10000704 Ga0163162_100007048 212
64 3300013307 Ga0157372_10284780 Ga0157372_102847804 212
65 3300014325 Ga0163163_10652098 Ga0163163_106520982 212
66 3300015261 Ga0182006_1000999 Ga0182006_10009993 212
67 3300017792 Ga0163161_10000189 Ga0163161_1000018915 212
68 3300025292 Ga0209676_1001309 Ga0209676_10013094 212
69 3300025298 Ga0209050_1000630 Ga0209050_100063014 212
70 3300025914 Ga0207671_10056624 Ga0207671_100566242 212
71 3300025937 Ga0207669_10101339 Ga0207669_101013391 212
72 3300025942 Ga0207689_10006265 Ga0207689_100062656 212
73 3300025961 Ga0207712_10057466 Ga0207712_100574664 212
74 3300025961 Ga0207712_10110846 Ga0207712_101108462 212
75 3300025961 Ga0207712_10325536 Ga0207712_103255362 212
76 3300025972 Ga0207668_10233409 Ga0207668_102334092 212
77 3300025972 Ga0207668_10831126 Ga0207668_108311261 212
78 3300025981 Ga0207640_10654155 Ga0207640_106541551 212
79 3300025986 Ga0207658_10253626 Ga0207658_102536262 212
80 3300026067 Ga0207678_10477173 Ga0207678_104771731 212
81 3300026088 Ga0207641_10094181 Ga0207641_100941815 212
82 3300026089 Ga0207648_10140361 Ga0207648_101403612 212
83 3300026118 Ga0207675_100013003 Ga0207675_1000130039 212
84 3300026118 Ga0207675_100826864 Ga0207675_1008268641 212
85 3300028379 Ga0268266_10000104 Ga0268266_1000010496 212
86 3300028380 Ga0268265_10053316 Ga0268265_100533164 212
87 3300028380 Ga0268265_10515880 Ga0268265_105158801 212
88 3300028381 Ga0268264_10000028 Ga0268264_1000002830 212
89 3300028381 Ga0268264_10310435 Ga0268264_103104352 212
90 3300028794 Ga0307515_10000261 Ga0307515_10000261104 212
91 3300031901 Ga0307406_10000026 Ga0307406_1000002659 212
92 3300031911 Ga0307412_10025183 Ga0307412_100251833 212
93 3300031995 Ga0307409_100268219 Ga0307409_1002682191 212
94 3300041512 Ga0451853_1086216 Ga0451853_1086216_163_801 212
95 3300042876 Ga0451577_0039474 Ga0451577_0039474_2547_3197 212
96 3300044673 Ga0453683_0151470 Ga0453683_0151470_25_675 212
97 3300046453 Ga0495627_011118 Ga0495627_011118_1158_1796 212
98 3300046460 Ga0495638_0195279 Ga0495638_0195279_433_1071 212
99 3300046522 Ga0495643_0004660 Ga0495643_0004660_6312_6950 212
100 3300046522 Ga0495643_0120968 Ga0495643_0120968_231_869 212
101 3300046616 Ga0495668_0000331 Ga0495668_0000331_17954_18592 212
102 3300046616 Ga0495668_0004116 Ga0495668_0004116_9212_9850 212
103 3300047320 Ga0495672_0018456 Ga0495672_0018456_3364_4002 212
104 3300047472 Ga0495686_0000125 Ga0495686_0000125_4592_5230 212
105 3300048919 Ga0496116_0000079 Ga0496116_0000079_200861_201499 212
106 3300048920 Ga0496117_0101939 Ga0496117_0101939_597_1235 212
107 3300048924 Ga0496121_0019965 Ga0496121_0019965_5480_6118 212
108 3300048928 Ga0496125_0001078 Ga0496125_0001078_24867_25505 212
109 3300048929 Ga0496126_0010175 Ga0496126_0010175_529_1167 212
110 3300048929 Ga0496126_0014994 Ga0496126_0014994_4850_5488 212
111 3300048929 Ga0496126_0114825 Ga0496126_0114825_487_1125 212
112 3300049649 Ga0501198_035621 Ga0501198_035621_131_769 212
113 3300050511 nmdc:mga08y16_294045_c1 nmdc:mga08y16_294045_c1_41_679 212
114 3300053088 Ga0500644_0000580 Ga0500644_0000580_10592_11230 212
115 3300053108 Ga0500562_032170 Ga0500562_032170_68_706 212
116 3300053131 Ga0500652_046114 Ga0500652_046114_17_655 212
117 3300053136 Ga0500559_0143618 Ga0500559_0143618_241_879 212
118 3300053139 Ga0500568_0018232 Ga0500568_0018232_373_1011 212
119 3300053153 Ga0500616_0045321 Ga0500616_0045321_1398_2036 212
120 3300053161 Ga0500634_0060200 Ga0500634_0060200_942_1580 212
121 3300053727 Ga0500611_000012 Ga0500611_000012_119888_120526 212
122 3300053730 Ga0500645_073444 Ga0500645_073444_290_928 212
123 3300032004 Ga0307414_10021401 Ga0307414_100214015 213
124 2162886007 SwRhRL2b_contig_1556754 SwRhRL2b_0545.00003290 215
125 3300005288 Ga0065714_10002529 Ga0065714_100025299 215
126 3300005289 Ga0065704_10070217 Ga0065704_1007021743 215
127 3300005290 Ga0065712_10102513 Ga0065712_101025133 215
128 3300005327 Ga0070658_10088683 Ga0070658_100886832 215
129 3300005329 Ga0070683_100024534 Ga0070683_1000245344 215
130 3300005331 Ga0070670_100028202 Ga0070670_1000282026 215
131 3300005331 Ga0070670_100357870 Ga0070670_1003578702 215
132 3300005344 Ga0070661_100021753 Ga0070661_1000217535 215
133 3300005354 Ga0070675_100179381 Ga0070675_1001793812 215
134 3300005355 Ga0070671_100135021 Ga0070671_1001350212 215
135 3300005355 Ga0070671_100151644 Ga0070671_1001516442 215
136 3300005367 Ga0070667_100154695 Ga0070667_1001546952 215
137 3300005535 Ga0070684_100004933 Ga0070684_1000049332 215
138 3300005564 Ga0070664_100023878 Ga0070664_1000238782 215
139 3300005844 Ga0068862_100116899 Ga0068862_1001168992 215
140 3300013100 Ga0157373_10000440 Ga0157373_1000044027 215
141 3300013102 Ga0157371_10394054 Ga0157371_103940542 215
142 3300013296 Ga0157374_10314401 Ga0157374_103144011 215
143 3300014325 Ga0163163_10000557 Ga0163163_100005576 215
144 3300014326 Ga0157380_10831026 Ga0157380_108310262 215
145 3300014497 Ga0182008_10000049 Ga0182008_100000497 215
146 3300014745 Ga0157377_10099463 Ga0157377_100994632 215
147 3300014968 Ga0157379_10320194 Ga0157379_103201941 215
148 3300025920 Ga0207649_10118229 Ga0207649_101182293 215
149 3300025925 Ga0207650_10003727 Ga0207650_1000372712 215
150 3300025925 Ga0207650_10397594 Ga0207650_103975941 215
151 3300025944 Ga0207661_10173478 Ga0207661_101734782 215
152 3300025945 Ga0207679_10027658 Ga0207679_100276587 215
153 3300025945 Ga0207679_10058101 Ga0207679_100581013 215
154 3300026142 Ga0207698_10129772 Ga0207698_101297723 215
155 3300028380 Ga0268265_10106534 Ga0268265_101065343 215
156 3300028381 Ga0268264_10005886 Ga0268264_100058868 215
157 3300031995 Ga0307409_100547641 Ga0307409_1005476412 215
158 3300048927 Ga0496124_0037362 Ga0496124_0037362_524_1207 215
159 3300049649 Ga0501198_008427 Ga0501198_008427_148_813 215
160 3300049663 Ga0501223_023486 Ga0501223_023486_399_1064 215
161 3300049682 Ga0501252_026767 Ga0501252_026767_107_772 215
162 3300049688 Ga0501259_001469 Ga0501259_001469_745_1410 215
163 3300049708 Ga0501245_001265 Ga0501245_001265_2485_3150 215
164 3300049763 Ga0501266_001309 Ga0501266_001309_1262_1927 215
165 3300049765 Ga0501268_000682 Ga0501268_000682_1245_1910 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

8

137

0.93

PF13460

NAD_binding_10

NAD(P)H-binding

12

159

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fmu-assembly1.cif.gz_A crystal structure of a tat-interacting protein homologue (htatip2, aw111545, cc3, tip30) from mus musculus at 2.30 a resolution 0.9186 1 214
2bka-assembly1.cif.gz_A-2 cc3(tip30)crystal structure 0.8594 1 214
2bka-assembly1.cif.gz_A-2 cc3(tip30)crystal structure 0.8518 1 214
6yj4-assembly1.cif.gz_P structure of yarrowia lipolytica complex i at 2.7 a 0.8373 4 156
2fmu-assembly1.cif.gz_A crystal structure of a tat-interacting protein homologue (htatip2, aw111545, cc3, tip30) from mus musculus at 2.30 a resolution 0.8336 1 214
ID Description Score Start End Superfamily
2fmuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9186 1 214 3.40.50.720
af_Q54U38_35_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8968 2 214 3.40.50.720
af_Q5DX36_1_216_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8917 4 214 3.40.50.720
af_P45469_1_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8756 4 214 3.40.50.720
af_Q5AP65_1_228_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8699 5 214 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1G0RSS6-F1-model_v4 NADH dehydrogenase 0.9953 4 148 GO:0016020
AF-A0A3D4AVI1-F1-model_v4 Short chain dehydrogenase 0.9916 3 150 GO:0005737
GO:0051170
AF-W1XU52-F1-model_v4 NAD(P)-binding domain-containing protein 0.9861 42 141
AF-A0A235F4S3-F1-model_v4 Oxidoreductase 0.9856 1 135
AF-A0A4Q3R6K8-F1-model_v4 Semialdehyde dehydrogenase 0.985 5 101 GO:0016620
GO:0051287

Feature Viewer

pLDDT pTM Quality
88.33 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map