F245673

General Info

Members Datasets Scaffolds Average Seq Length
165 118 165 223

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100005427|Ga0070686_1000054275
Length 236
Sequence VGGESHGEHDLGDDCLNALATVTVETGPNPVYTIIWMHGLGADGHDFEPLVPELQGGLPALRFVFPHAPVRPVTINNGYAMRAWYDIAGIDRRSAEDFKGIGETTDSISGLIHREHARGIGSDHILLAGFSQGGAMALHIATRHPDRFAGIIALSCYLPLSREFAKLRNTSNQSTPIFMAHGTQDPVVPYMLGDETRALMQSAGYAVEWHSYPMPHSLCADEVADLHAFLKRVTVA

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
83 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
84 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
92 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
93 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
94 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
95 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
103 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
104 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
105 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
106 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
107 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
108 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
115 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
116 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
117 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
118 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0
Rhizoplane 2.42
Rhizosphere 94.55
Stem 0
Stem Tuber 0
Unclassified 1.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10098935 3300003322 Bacteria 3001
2 Ga0070690_100393002 3300005330 Bacteria 1017
3 Ga0070670_100013396 3300005331 Bacteria 7024
4 Ga0070677_10049481 3300005333 Bacteria 1693
5 Ga0068869_100032666 3300005334 Bacteria 3669
6 Ga0070682_100038510 3300005337 Bacteria 2933
7 Ga0070682_100134929 3300005337 Bacteria 1675
8 Ga0070682_100386084 3300005337 Bacteria 1055
9 Ga0070689_100002142 3300005340 Bacteria 12806
10 Ga0070661_100205082 3300005344 Bacteria 1508
11 Ga0070668_100387167 3300005347 Bacteria 1191
12 Ga0070675_100077187 3300005354 Bacteria 2772
13 Ga0070674_100108352 3300005356 Bacteria 2036
14 Ga0070674_100231397 3300005356 Bacteria 1442
15 Ga0070673_100201032 3300005364 Bacteria 1716
16 Ga0070673_100211685 3300005364 Bacteria 1674
17 Ga0070688_100457838 3300005365 Bacteria 955
18 Ga0070701_10003717 3300005438 Bacteria 6090
19 Ga0070705_100013469 3300005440 Bacteria 4184
20 Ga0070700_100317335 3300005441 Bacteria 1143
21 Ga0070694_100219883 3300005444 Bacteria 1424
22 Ga0070685_10152711 3300005466 Bacteria 1465
23 Ga0070672_100059979 3300005543 Bacteria 2995
24 Ga0070672_100064660 3300005543 Bacteria 2891
25 Ga0070672_100200047 3300005543 Bacteria 1670
26 Ga0070686_100005427 3300005544 Bacteria 7058
27 Ga0070686_100035157 3300005544 Bacteria 3093
28 Ga0070696_100065024 3300005546 Bacteria 2556
29 Ga0070696_100096661 3300005546 Bacteria 2111
30 Ga0070665_100008445 3300005548 Bacteria 10419
31 Ga0070664_100134268 3300005564 Bacteria 2175
32 Ga0070664_100662408 3300005564 Bacteria 971
33 Ga0068857_100145808 3300005577 Bacteria 2142
34 Ga0068859_100018992 3300005617 Bacteria 6904
35 Ga0068859_100140047 3300005617 Bacteria 2493
36 Ga0068864_100022389 3300005618 Bacteria 5299
37 Ga0068861_100052676 3300005719 Bacteria 3094
38 Ga0068861_100149717 3300005719 Bacteria 1914
39 Ga0068863_100348258 3300005841 Bacteria 1442
40 Ga0068858_100052379 3300005842 Bacteria 3776
41 Ga0068858_100524135 3300005842 Bacteria 1146
42 Ga0068860_100487156 3300005843 Bacteria 1230
43 Ga0068862_100067425 3300005844 Bacteria 3085
44 Ga0097621_100046563 3300006237 Bacteria 3510
45 Ga0097621_100136628 3300006237 Bacteria 2091
46 Ga0097621_100264985 3300006237 Bacteria 1508
47 Ga0068871_100010911 3300006358 Bacteria 6653
48 Ga0068871_100088369 3300006358 Bacteria 2578
49 Ga0068865_100010831 3300006881 Bacteria 5689
50 Ga0068865_100174385 3300006881 Bacteria 1651
51 Ga0097620_100018992 3300006931 Bacteria 6904
52 Ga0097620_100140044 3300006931 Bacteria 2493
53 Ga0105240_10212424 3300009093 Bacteria 2260
54 Ga0111539_10016033 3300009094 Bacteria 9302
55 Ga0105243_10635804 3300009148 Bacteria 1032
56 Ga0105242_10047024 3300009176 Bacteria 3503
57 Ga0105248_10082253 3300009177 Bacteria 3620
58 Ga0157374_10085546 3300013296 Bacteria 2999
59 Ga0157378_10350536 3300013297 Bacteria 1442
60 Ga0157375_10048398 3300013308 Bacteria 4159
61 Ga0157375_10367512 3300013308 Bacteria 1605
62 Ga0163163_10032789 3300014325 Bacteria 5019
63 Ga0157380_10010844 3300014326 Bacteria 6570
64 Ga0157380_10349268 3300014326 Bacteria 1383
65 Ga0157380_10389497 3300014326 Bacteria 1318
66 Ga0157380_10438689 3300014326 Bacteria 1251
67 Ga0157376_10092788 3300014969 Bacteria 2619
68 Ga0157376_10475311 3300014969 Bacteria 1224
69 Ga0163161_10084946 3300017792 Bacteria 2334
70 Ga0207682_10017973 3300025893 Bacteria 2760
71 Ga0207688_10430261 3300025901 Bacteria 821
72 Ga0207643_10011840 3300025908 Bacteria 4707
73 Ga0207662_10024201 3300025918 Bacteria 3494
74 Ga0207649_10120496 3300025920 Bacteria 1768
75 Ga0207650_10063960 3300025925 Bacteria 2752
76 Ga0207686_10194906 3300025934 Bacteria 1447
77 Ga0207709_10596273 3300025935 Bacteria 874
78 Ga0207670_10022402 3300025936 Bacteria 3915
79 Ga0207670_10483694 3300025936 Bacteria 1003
80 Ga0207669_10077376 3300025937 Bacteria 2115
81 Ga0207704_10049488 3300025938 Bacteria 2529
82 Ga0207704_10448972 3300025938 Bacteria 1029
83 Ga0207691_10090719 3300025940 Bacteria 2739
84 Ga0207691_10131915 3300025940 Bacteria 2206
85 Ga0207689_10104879 3300025942 Bacteria 2323
86 Ga0207689_10137520 3300025942 Bacteria 2012
87 Ga0207679_10140719 3300025945 Bacteria 1950
88 Ga0207712_10401595 3300025961 Bacteria 1152
89 Ga0207677_10142362 3300026023 Bacteria 1838
90 Ga0207703_10062943 3300026035 Bacteria 3040
91 Ga0207708_10122541 3300026075 Bacteria 2027
92 Ga0207641_10850464 3300026088 Bacteria 904
93 Ga0207648_10486152 3300026089 Bacteria 1128
94 Ga0207676_10090738 3300026095 Bacteria 2508
95 Ga0207675_100004052 3300026118 Bacteria 14192
96 Ga0207675_100034948 3300026118 Bacteria 4687
97 Ga0207675_100058345 3300026118 Bacteria 3602
98 Ga0207675_100119328 3300026118 Bacteria 2494
99 Ga0268265_10054447 3300028380 Bacteria 3036
100 Ga0268264_10045906 3300028381 Bacteria 3628
101 Ga0268264_11005393 3300028381 Bacteria 840
102 Ga0307513_10141539 3300031456 Bacteria 2331
103 Ga0307405_10038579 3300031731 Bacteria 2881
104 Ga0307413_10019615 3300031824 Bacteria 3578
105 Ga0307413_10045576 3300031824 Bacteria 2600
106 Ga0307410_10001455 3300031852 Bacteria 10694
107 Ga0307410_10812415 3300031852 Bacteria 796
108 Ga0307406_10014745 3300031901 Bacteria 4503
109 Ga0307407_10002863 3300031903 Bacteria 6900
110 Ga0307407_10050783 3300031903 Bacteria 2374
111 Ga0307409_100012806 3300031995 Bacteria 5363
112 Ga0307409_100016266 3300031995 Bacteria 4916
113 Ga0307409_100127956 3300031995 Bacteria 2164
114 Ga0307416_100027209 3300032002 Bacteria 4231
115 Ga0307416_100161858 3300032002 Bacteria 2070
116 Ga0307416_100505481 3300032002 Bacteria 1274
117 Ga0307414_10057414 3300032004 Bacteria 2736
118 Ga0307415_100069471 3300032126 Bacteria 2470
119 Ga0307415_100305763 3300032126 Bacteria 1319
120 Ga0373945_0258773 3300035116 Bacteria 737
121 Ga0373954_0099090 3300035118 Bacteria 1405
122 Ga0373956_0100084 3300035119 Bacteria 1344
123 Ga0373955_0060997 3300035172 Bacteria 2082
124 Ga0373955_0428390 3300035172 Bacteria 805
125 Ga0316574_0031146 3300035398 Bacteria 3234
126 Ga0316574_0054191 3300035398 Bacteria 2504
127 Ga0373935_0392168 3300035692 Bacteria 996
128 Ga0373933_0088673 3300035724 Bacteria 1906
129 Ga0373933_0180399 3300035724 Bacteria 1347
130 Ga0373937_0003083 3300036401 Bacteria 13938
131 Ga0373937_0410733 3300036401 Bacteria 1284
132 Ga0373925_0596788 3300037068 Bacteria 909
133 Ga0436363_0366089 3300039450 Unclassified 2321
134 Ga0451797_1235790 3300041453 Bacteria 1200
135 Ga0451798_0888161 3300041458 Bacteria 742
136 Ga0451802_0868198 3300041460 Bacteria 864
137 Ga0451807_1983790 3300041486 Bacteria 1786
138 Ga0495638_0011738 3300046460 Bacteria 6031
139 Ga0495638_0089754 3300046460 Bacteria 1853
140 Ga0495580_0025636 3300046472 Bacteria 4309
141 Ga0495664_0334797 3300046477 Bacteria 912
142 Ga0495616_0003020 3300046513 Bacteria 10926
143 Ga0495587_0137781 3300046536 Bacteria 1394
144 Ga0495625_0042349 3300046660 Bacteria 3310
145 Ga0495625_0101169 3300046660 Bacteria 1980
146 Ga0495625_0109340 3300046660 Bacteria 1891
147 Ga0495649_0283971 3300046694 Bacteria 845
148 Ga0495602_0145486 3300048088 Bacteria 1870
149 Ga0501067_0007103 3300049583 Bacteria 6219
150 Ga0501068_0013874 3300049584 Bacteria 4593
151 Ga0501070_0042400 3300049586 Bacteria 3790
152 Ga0501071_0033875 3300049587 Bacteria 3631
153 Ga0501071_0357713 3300049587 Bacteria 1111
154 Ga0501073_0028842 3300049589 Bacteria 3965
155 Ga0501074_0013592 3300049590 Bacteria 5918
156 Ga0501076_0042618 3300049592 Bacteria 3574
157 Ga0501077_0227009 3300049593 Bacteria 1187
158 Ga0501079_0007473 3300049741 Bacteria 8265
159 Ga0501079_0799091 3300049741 Bacteria 743
160 Ga0501080_0003795 3300049742 Bacteria 13344
161 Ga0500616_0015239 3300053153 Bacteria 4400
162 Ga0500634_0021944 3300053161 Bacteria 3462
163 Ga0501084_0099013 3300054114 Bacteria 2448
164 Ga0501082_0191850 3300060353 Bacteria 1777
165 Ga0530510_0585531 3300061734 Bacteria 848

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035172 Ga0373955_0428390 Ga0373955_0428390_185_784 199
2 3300026089 Ga0207648_10486152 Ga0207648_104861522 200
3 3300041453 Ga0451797_1235790 Ga0451797_1235790_584_1186 200
4 3300046477 Ga0495664_0334797 Ga0495664_0334797_23_625 200
5 3300049593 Ga0501077_0227009 Ga0501077_0227009_25_648 202
6 3300049741 Ga0501079_0799091 Ga0501079_0799091_93_716 202
7 3300032002 Ga0307416_100505481 Ga0307416_1005054812 209
8 3300009148 Ga0105243_10635804 Ga0105243_106358041 217
9 3300014326 Ga0157380_10389497 Ga0157380_103894972 219
10 3300049586 Ga0501070_0042400 Ga0501070_0042400_2046_2705 219
11 3300005546 Ga0070696_100065024 Ga0070696_1000650243 220
12 3300009093 Ga0105240_10212424 Ga0105240_102124243 220
13 3300031824 Ga0307413_10045576 Ga0307413_100455764 220
14 3300031852 Ga0307410_10812415 Ga0307410_108124152 220
15 3300031903 Ga0307407_10002863 Ga0307407_100028634 220
16 3300031995 Ga0307409_100012806 Ga0307409_1000128065 220
17 3300032004 Ga0307414_10057414 Ga0307414_100574141 220
18 3300035118 Ga0373954_0099090 Ga0373954_0099090_381_1043 220
19 3300035119 Ga0373956_0100084 Ga0373956_0100084_659_1321 220
20 3300035172 Ga0373955_0060997 Ga0373955_0060997_361_1023 220
21 3300035724 Ga0373933_0088673 Ga0373933_0088673_1107_1769 220
22 3300035724 Ga0373933_0180399 Ga0373933_0180399_580_1242 220
23 3300036401 Ga0373937_0003083 Ga0373937_0003083_13067_13729 220
24 3300037068 Ga0373925_0596788 Ga0373925_0596788_213_875 220
25 3300039450 Ga0436363_0366089 Ga0436363_0366089_861_1523 220
26 3300041458 Ga0451798_0888161 Ga0451798_0888161_21_689 220
27 3300041460 Ga0451802_0868198 Ga0451802_0868198_48_731 220
28 3300041486 Ga0451807_1983790 Ga0451807_1983790_552_1235 220
29 3300046472 Ga0495580_0025636 Ga0495580_0025636_257_919 220
30 3300046513 Ga0495616_0003020 Ga0495616_0003020_8930_9592 220
31 3300046536 Ga0495587_0137781 Ga0495587_0137781_519_1181 220
32 3300048088 Ga0495602_0145486 Ga0495602_0145486_793_1455 220
33 3300053153 Ga0500616_0015239 Ga0500616_0015239_2742_3425 220
34 3300005330 Ga0070690_100393002 Ga0070690_1003930021 221
35 3300005337 Ga0070682_100038510 Ga0070682_1000385103 221
36 3300005340 Ga0070689_100002142 Ga0070689_10000214212 221
37 3300005438 Ga0070701_10003717 Ga0070701_100037175 221
38 3300005440 Ga0070705_100013469 Ga0070705_1000134694 221
39 3300005544 Ga0070686_100005427 Ga0070686_1000054275 221
40 3300005546 Ga0070696_100096661 Ga0070696_1000966611 221
41 3300005577 Ga0068857_100145808 Ga0068857_1001458082 221
42 3300005617 Ga0068859_100018992 Ga0068859_1000189923 221
43 3300005618 Ga0068864_100022389 Ga0068864_1000223895 221
44 3300005842 Ga0068858_100052379 Ga0068858_1000523795 221
45 3300005843 Ga0068860_100487156 Ga0068860_1004871562 221
46 3300005844 Ga0068862_100067425 Ga0068862_1000674253 221
47 3300006931 Ga0097620_100018992 Ga0097620_1000189926 221
48 3300014326 Ga0157380_10438689 Ga0157380_104386892 221
49 3300025918 Ga0207662_10024201 Ga0207662_100242012 221
50 3300025936 Ga0207670_10022402 Ga0207670_100224023 221
51 3300026035 Ga0207703_10062943 Ga0207703_100629432 221
52 3300026095 Ga0207676_10090738 Ga0207676_100907382 221
53 3300026118 Ga0207675_100004052 Ga0207675_1000040526 221
54 3300028380 Ga0268265_10054447 Ga0268265_100544473 221
55 3300028381 Ga0268264_10045906 Ga0268264_100459063 221
56 3300035398 Ga0316574_0031146 Ga0316574_0031146_379_1092 221
57 3300035398 Ga0316574_0054191 Ga0316574_0054191_210_917 221
58 3300046460 Ga0495638_0089754 Ga0495638_0089754_1073_1738 221
59 3300046694 Ga0495649_0283971 Ga0495649_0283971_98_766 221
60 3300053161 Ga0500634_0021944 Ga0500634_0021944_351_1025 221
61 3300005331 Ga0070670_100013396 Ga0070670_1000133961 222
62 3300005334 Ga0068869_100032666 Ga0068869_1000326664 222
63 3300005337 Ga0070682_100134929 Ga0070682_1001349292 222
64 3300005337 Ga0070682_100386084 Ga0070682_1003860842 222
65 3300005344 Ga0070661_100205082 Ga0070661_1002050822 222
66 3300005347 Ga0070668_100387167 Ga0070668_1003871672 222
67 3300005364 Ga0070673_100201032 Ga0070673_1002010322 222
68 3300005365 Ga0070688_100457838 Ga0070688_1004578382 222
69 3300005543 Ga0070672_100064660 Ga0070672_1000646602 222
70 3300005544 Ga0070686_100035157 Ga0070686_1000351572 222
71 3300005548 Ga0070665_100008445 Ga0070665_1000084459 222
72 3300005564 Ga0070664_100134268 Ga0070664_1001342682 222
73 3300005617 Ga0068859_100140047 Ga0068859_1001400472 222
74 3300005719 Ga0068861_100149717 Ga0068861_1001497172 222
75 3300005842 Ga0068858_100524135 Ga0068858_1005241351 222
76 3300006237 Ga0097621_100136628 Ga0097621_1001366282 222
77 3300006237 Ga0097621_100264985 Ga0097621_1002649852 222
78 3300006358 Ga0068871_100088369 Ga0068871_1000883693 222
79 3300006931 Ga0097620_100140044 Ga0097620_1001400442 222
80 3300009176 Ga0105242_10047024 Ga0105242_100470243 222
81 3300009177 Ga0105248_10082253 Ga0105248_100822532 222
82 3300013296 Ga0157374_10085546 Ga0157374_100855462 222
83 3300013308 Ga0157375_10367512 Ga0157375_103675122 222
84 3300014325 Ga0163163_10032789 Ga0163163_100327892 222
85 3300014969 Ga0157376_10475311 Ga0157376_104753112 222
86 3300017792 Ga0163161_10084946 Ga0163161_100849463 222
87 3300025920 Ga0207649_10120496 Ga0207649_101204961 222
88 3300025925 Ga0207650_10063960 Ga0207650_100639603 222
89 3300025934 Ga0207686_10194906 Ga0207686_101949062 222
90 3300025940 Ga0207691_10090719 Ga0207691_100907192 222
91 3300025942 Ga0207689_10104879 Ga0207689_101048793 222
92 3300025942 Ga0207689_10137520 Ga0207689_101375202 222
93 3300025961 Ga0207712_10401595 Ga0207712_104015952 222
94 3300026023 Ga0207677_10142362 Ga0207677_101423622 222
95 3300026075 Ga0207708_10122541 Ga0207708_101225412 222
96 3300026118 Ga0207675_100058345 Ga0207675_1000583454 222
97 3300026118 Ga0207675_100119328 Ga0207675_1001193282 222
98 3300028381 Ga0268264_11005393 Ga0268264_110053932 222
99 3300031731 Ga0307405_10038579 Ga0307405_100385793 222
100 3300031824 Ga0307413_10019615 Ga0307413_100196152 222
101 3300031852 Ga0307410_10001455 Ga0307410_100014554 222
102 3300031901 Ga0307406_10014745 Ga0307406_100147453 222
103 3300031903 Ga0307407_10050783 Ga0307407_100507832 222
104 3300031995 Ga0307409_100016266 Ga0307409_1000162666 222
105 3300031995 Ga0307409_100127956 Ga0307409_1001279562 222
106 3300032002 Ga0307416_100027209 Ga0307416_1000272092 222
107 3300032126 Ga0307415_100069471 Ga0307415_1000694713 222
108 3300032126 Ga0307415_100305763 Ga0307415_1003057632 222
109 3300046460 Ga0495638_0011738 Ga0495638_0011738_2857_3525 222
110 3300046660 Ga0495625_0042349 Ga0495625_0042349_1035_1709 222
111 3300046660 Ga0495625_0101169 Ga0495625_0101169_219_887 222
112 3300003322 rootL2_10098935 rootL2_100989353 223
113 3300005333 Ga0070677_10049481 Ga0070677_100494812 223
114 3300005354 Ga0070675_100077187 Ga0070675_1000771872 223
115 3300005356 Ga0070674_100108352 Ga0070674_1001083522 223
116 3300005356 Ga0070674_100231397 Ga0070674_1002313972 223
117 3300005364 Ga0070673_100211685 Ga0070673_1002116852 223
118 3300005441 Ga0070700_100317335 Ga0070700_1003173352 223
119 3300005444 Ga0070694_100219883 Ga0070694_1002198832 223
120 3300005466 Ga0070685_10152711 Ga0070685_101527112 223
121 3300005543 Ga0070672_100059979 Ga0070672_1000599793 223
122 3300005543 Ga0070672_100200047 Ga0070672_1002000472 223
123 3300005564 Ga0070664_100662408 Ga0070664_1006624082 223
124 3300005719 Ga0068861_100052676 Ga0068861_1000526763 223
125 3300005841 Ga0068863_100348258 Ga0068863_1003482581 223
126 3300006237 Ga0097621_100046563 Ga0097621_1000465631 223
127 3300006358 Ga0068871_100010911 Ga0068871_1000109113 223
128 3300006881 Ga0068865_100010831 Ga0068865_1000108314 223
129 3300006881 Ga0068865_100174385 Ga0068865_1001743852 223
130 3300009094 Ga0111539_10016033 Ga0111539_1001603310 223
131 3300013297 Ga0157378_10350536 Ga0157378_103505362 223
132 3300013308 Ga0157375_10048398 Ga0157375_100483982 223
133 3300014326 Ga0157380_10010844 Ga0157380_100108444 223
134 3300014326 Ga0157380_10349268 Ga0157380_103492682 223
135 3300014969 Ga0157376_10092788 Ga0157376_100927883 223
136 3300025893 Ga0207682_10017973 Ga0207682_100179732 223
137 3300025901 Ga0207688_10430261 Ga0207688_104302611 223
138 3300025908 Ga0207643_10011840 Ga0207643_100118405 223
139 3300025935 Ga0207709_10596273 Ga0207709_105962731 223
140 3300025936 Ga0207670_10483694 Ga0207670_104836942 223
141 3300025937 Ga0207669_10077376 Ga0207669_100773762 223
142 3300025938 Ga0207704_10049488 Ga0207704_100494882 223
143 3300025938 Ga0207704_10448972 Ga0207704_104489722 223
144 3300025940 Ga0207691_10131915 Ga0207691_101319151 223
145 3300025945 Ga0207679_10140719 Ga0207679_101407192 223
146 3300026088 Ga0207641_10850464 Ga0207641_108504641 223
147 3300026118 Ga0207675_100034948 Ga0207675_1000349485 223
148 3300031456 Ga0307513_10141539 Ga0307513_101415392 223
149 3300032002 Ga0307416_100161858 Ga0307416_1001618582 223
150 3300035116 Ga0373945_0258773 Ga0373945_0258773_10_681 223
151 3300035692 Ga0373935_0392168 Ga0373935_0392168_25_696 223
152 3300036401 Ga0373937_0410733 Ga0373937_0410733_355_1026 223
153 3300046660 Ga0495625_0109340 Ga0495625_0109340_773_1465 223
154 3300049583 Ga0501067_0007103 Ga0501067_0007103_809_1549 223
155 3300049584 Ga0501068_0013874 Ga0501068_0013874_3287_3967 223
156 3300049587 Ga0501071_0033875 Ga0501071_0033875_2532_3218 223
157 3300049587 Ga0501071_0357713 Ga0501071_0357713_361_1062 223
158 3300049589 Ga0501073_0028842 Ga0501073_0028842_65_745 223
159 3300049590 Ga0501074_0013592 Ga0501074_0013592_164_910 223
160 3300049592 Ga0501076_0042618 Ga0501076_0042618_2287_2973 223
161 3300049741 Ga0501079_0007473 Ga0501079_0007473_154_834 223
162 3300049742 Ga0501080_0003795 Ga0501080_0003795_3087_3827 223
163 3300054114 Ga0501084_0099013 Ga0501084_0099013_1131_1817 223
164 3300060353 Ga0501082_0191850 Ga0501082_0191850_284_964 223
165 3300061734 Ga0530510_0585531 Ga0530510_0585531_39_785 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02230

Abhydrolase_2

Phospholipase/Carboxylesterase

19

234

0.95

PF01738

DLH

Dienelactone hydrolase family

97

230

0.85

PF03959

FSH1

Serine hydrolase (FSH1)

30

218

0.8

PF00756

Esterase

Putative esterase

111

213

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6avw-assembly1.cif.gz_A crystal structure of arabidopsis thaliana sober1 l63a 0.9521 17 219
6avx-assembly1.cif.gz_A crystal structure of arabidopsis thaliana sober1 f65l 0.9508 18 219
3cn7-assembly3.cif.gz_C crystal structure analysis of the carboxylesterase pa3859 from pseudomonas aeruginosa pao1- monoclinic crystal form 0.9499 5 218
6avv-assembly1.cif.gz_A crystal structure of arabidopsis thaliana sober1 0.9496 17 219
5syn-assembly3.cif.gz_C cocrystal structure of the human acyl protein thioesterase 2 with an isoform-selective inhibitor, ml349 0.948 4 223
ID Description Score Start End Superfamily
af_Q12354_5_226_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9586 14 221 3.40.50.1820
af_Q55FK4_1_222_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9583 6 222 3.40.50.1820
3cn7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9498 5 218 3.40.50.1820
af_Q54T49_3_226_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9476 6 222 3.40.50.1820
af_O42881_1_222_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9472 1 220 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7C4E9R3-F1-model_v4 Carboxylesterase 0.9937 97 220 GO:0016787
AF-A0A7C7G4M2-F1-model_v4 Carboxylesterase 0.9933 114 219 GO:0016787
AF-A0A536VJV7-F1-model_v4 Carboxylesterase 0.993 136 219 GO:0016787
AF-A0A536YKE2-F1-model_v4 Carboxylesterase 0.9923 127 219 GO:0016787
AF-A0A3C1N676-F1-model_v4 Carboxylesterase 0.9915 88 220 GO:0016787

Feature Viewer

pLDDT pTM Quality
94.95 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map