F245641

General Info

Members Datasets Scaffolds Average Seq Length
165 123 330 136

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100000701|Ga0070699_1000007017
Length 159
Sequence VTPPRERVKRAAPRAPAGPKPRKPASVGYSGTPLPQKLGFKEGTQAAVAGAPDGLKRLLGALPKGATLAAPASAVLDLGVLFATRAVDLRRAVPIWIHRLKPAGMLWIAWPKKASGAETDLTEDVVRLVGLQGGLVDVKVCAIDATWSGLKFVRRLRDR

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
43 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
57 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
58 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
59 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
60 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
61 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
62 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
68 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
69 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
70 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
71 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
72 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
73 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
74 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
75 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
76 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
77 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
78 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
91 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
92 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
96 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
116 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
121 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
122 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
123 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 0
Isolates 1.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.61
Rhizoplane 18.18
Rhizosphere 77.58
Stem 0
Stem Tuber 0
Unclassified 9.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100000701 3300005518 Bacteria 31013
2 Ga0068869_100982340 3300005334 Unclassified 734
3 Ga0070666_11073567 3300005335 Bacteria 598
4 Ga0068868_100851080 3300005338 Unclassified 826
5 Ga0070692_10020298 3300005345 Bacteria 3221
6 Ga0070674_100196422 3300005356 Bacteria 1555
7 Ga0070710_10000050 3300005437 Bacteria 56781
8 Ga0070708_100909804 3300005445 Bacteria 826
9 Ga0070663_101008304 3300005455 Bacteria 724
10 Ga0068867_102196298 3300005459 Unclassified 524
11 Ga0070685_10156263 3300005466 Bacteria 1450
12 Ga0070706_100316109 3300005467 Bacteria 1457
13 Ga0070706_100605869 3300005467 Bacteria 1018
14 Ga0070707_100439091 3300005468 Bacteria 1266
15 Ga0070698_101686244 3300005471 Unclassified 586
16 Ga0070684_101959573 3300005535 Bacteria 553
17 Ga0070696_100010460 3300005546 Bacteria 6218
18 Ga0070693_100534573 3300005547 Bacteria 837
19 Ga0070704_100002378 3300005549 Bacteria 10556
20 Ga0068859_102385577 3300005617 Bacteria 583
21 Ga0068870_10316152 3300005840 Bacteria 991
22 Ga0068858_100796939 3300005842 Bacteria 922
23 Ga0070715_10506600 3300006163 Bacteria 692
24 Ga0097621_100369483 3300006237 Bacteria 1279
25 Ga0075430_100413114 3300006846 Bacteria 1114
26 Ga0075431_100108759 3300006847 Bacteria 2861
27 Ga0075431_100151693 3300006847 Bacteria 2386
28 Ga0075431_100169082 3300006847 Bacteria 2247
29 Ga0075433_10491662 3300006852 Bacteria 1080
30 Ga0097620_102385585 3300006931 Bacteria 583
31 Ga0111539_10215168 3300009094 Bacteria 2238
32 Ga0111539_11219236 3300009094 Bacteria 874
33 Ga0105245_10086539 3300009098 Bacteria 2874
34 Ga0105245_10139356 3300009098 Bacteria 2283
35 Ga0105245_10198492 3300009098 Bacteria 1926
36 Ga0105245_10530354 3300009098 Bacteria 1197
37 Ga0105245_10554842 3300009098 Bacteria 1171
38 Ga0105245_11185439 3300009098 Bacteria 811
39 Ga0105245_12801021 3300009098 Bacteria 540
40 Ga0114129_10100208 3300009147 Bacteria 4008
41 Ga0105243_10443444 3300009148 Bacteria 1216
42 Ga0105243_10483843 3300009148 Bacteria 1169
43 Ga0105238_12119190 3300009551 Bacteria 597
44 Ga0105239_10244608 3300010375 Bacteria 2014
45 Ga0105246_11937573 3300011119 Unclassified 567
46 Ga0157375_11610554 3300013308 Unclassified 768
47 Ga0163163_10702558 3300014325 Bacteria 1075
48 Ga0163163_10710663 3300014325 Bacteria 1068
49 Ga0163163_11181337 3300014325 Bacteria 828
50 Ga0157380_10531989 3300014326 Bacteria 1149
51 Ga0157379_10891835 3300014968 Bacteria 843
52 Ga0157376_10005699 3300014969 Bacteria 8724
53 Ga0157376_10523587 3300014969 Bacteria 1169
54 Ga0182006_1058839 3300015261 Bacteria 1456
55 Ga0182007_10048656 3300015262 Bacteria 1401
56 Ga0213872_10059357 3300021361 Bacteria 1731
57 Ga0213871_10131334 3300021441 Bacteria 752
58 Ga0207692_10000022 3300025898 Bacteria 56680
59 Ga0207685_10365541 3300025905 Bacteria 731
60 Ga0207671_10542447 3300025914 Bacteria 927
61 Ga0207687_10074360 3300025927 Bacteria 2435
62 Ga0207687_11570214 3300025927 Bacteria 565
63 Ga0207689_10153205 3300025942 Bacteria 1900
64 Ga0207661_10247801 3300025944 Bacteria 1582
65 Ga0207661_10493740 3300025944 Bacteria 1118
66 Ga0207677_10612649 3300026023 Bacteria 957
67 Ga0207678_10942395 3300026067 Bacteria 764
68 Ga0307408_100983792 3300031548 Bacteria 777
69 Ga0307413_10366939 3300031824 Bacteria 1117
70 Ga0307407_10058560 3300031903 Bacteria 2240
71 Ga0307415_100264525 3300032126 Bacteria 1405
72 Ga0373926_0074419 3300035083 Bacteria 1251
73 Ga0373945_0512371 3300035116 Bacteria 535
74 Ga0373960_0174188 3300035121 Bacteria 748
75 Ga0373924_0220156 3300035410 Bacteria 839
76 Ga0373931_0394821 3300035691 Bacteria 875
77 Ga0373927_0002039 3300035695 Bacteria 14879
78 Ga0373927_0021253 3300035695 Bacteria 4253
79 Ga0373947_0528656 3300035725 Bacteria 802
80 Ga0373937_1015381 3300036401 Bacteria 778
81 Ga0373937_1678114 3300036401 Bacteria 582
82 Ga0373925_0089757 3300037068 Bacteria 2348
83 Ga0373925_0269671 3300037068 Bacteria 1369
84 Ga0373925_1426439 3300037068 Bacteria 567
85 Ga0395900_0853856 3300037418 Bacteria 836
86 Ga0395905_0125750 3300037471 Bacteria 2411
87 Ga0436360_1083913 3300039438 Bacteria 820
88 Ga0436361_0804016 3300039447 Bacteria 2841
89 Ga0436361_0919827 3300039447 Bacteria 2007
90 Ga0451789_0004610 3300041443 Bacteria 2753
91 Ga0451791_1440202 3300041451 Bacteria 805
92 Ga0451793_0557242 3300041452 Bacteria 2078
93 Ga0451797_0452481 3300041453 Bacteria 1782
94 Ga0451800_1344417 3300041459 Bacteria 666
95 Ga0451807_0194667 3300041486 Bacteria 1848
96 Ga0451833_0045601 3300041491 Bacteria 714
97 Ga0451841_1263702 3300041498 Bacteria 2914
98 Ga0451845_0137890 3300041501 Bacteria 798
99 Ga0451843_0067940 3300041509 Bacteria 3205
100 Ga0451853_1417811 3300041512 Bacteria 742
101 Ga0451853_1997680 3300041512 Bacteria 5562
102 Ga0466969_0126085 3300044656 Bacteria 1189
103 Ga0466966_0118089 3300044684 Bacteria 1631
104 Ga0466966_0575703 3300044684 Bacteria 678
105 Ga0466961_0042560 3300044693 Bacteria 2911
106 Ga0466963_0033278 3300044694 Bacteria 3345
107 Ga0466970_0066669 3300044765 Bacteria 1933
108 Ga0466957_0063969 3300044842 Bacteria 2263
109 Ga0466959_0571961 3300045049 Bacteria 761
110 Ga0466967_0044372 3300045976 Bacteria 3856
111 Ga0466967_0319159 3300045976 Bacteria 1498
112 Ga0466967_0552024 3300045976 Bacteria 1134
113 Ga0466967_2297496 3300045976 Bacteria 535
114 Ga0466967_2365488 3300045976 Bacteria 527
115 Ga0495603_0001284 3300046455 Bacteria 14633
116 Ga0495653_0132085 3300046463 Unclassified 1766
117 Ga0495580_0077949 3300046472 Bacteria 2311
118 Ga0495580_0189362 3300046472 Bacteria 1419
119 Ga0495582_0161608 3300046473 Bacteria 1274
120 Ga0495582_0301541 3300046473 Bacteria 921
121 Ga0495662_0073792 3300046476 Bacteria 1655
122 Ga0495664_0315624 3300046477 Unclassified 943
123 Ga0495608_0081917 3300046511 Bacteria 2096
124 Ga0495588_0080785 3300046674 Bacteria 1697
125 Ga0495647_0165573 3300046681 Bacteria 955
126 Ga0495658_0232618 3300046683 Bacteria 1156
127 Ga0495600_0571027 3300046809 Unclassified 689
128 Ga0495581_0152227 3300047315 Bacteria 1351
129 Ga0496101_0339806 3300048904 Bacteria 1179
130 Ga0496102_0251486 3300048905 Bacteria 1666
131 Ga0496102_0738847 3300048905 Unclassified 907
132 Ga0496103_0089321 3300048906 Bacteria 1944
133 Ga0496103_0140661 3300048906 Bacteria 1543
134 Ga0496105_0112343 3300048908 Bacteria 2248
135 Ga0496106_0161078 3300048909 Bacteria 1774
136 Ga0496107_0106524 3300048910 Bacteria 2059
137 Ga0496108_0002395 3300048911 Bacteria 14992
138 Ga0496108_0772872 3300048911 Bacteria 830
139 Ga0496109_0006153 3300048912 Bacteria 10087
140 Ga0496109_0907308 3300048912 Unclassified 819
141 Ga0496109_1342143 3300048912 Bacteria 651
142 Ga0496110_0024168 3300048913 Bacteria 5175
143 Ga0496110_1771934 3300048913 Bacteria 528
144 Ga0496111_0003359 3300048914 Bacteria 9893
145 Ga0496111_0200267 3300048914 Bacteria 1484
146 Ga0496112_0286654 3300048915 Bacteria 1593
147 Ga0496112_0559172 3300048915 Bacteria 1078
148 Ga0496114_0057500 3300048917 Bacteria 3247
149 Ga0496114_0093634 3300048917 Bacteria 2555
150 Ga0496114_0819549 3300048917 Unclassified 810
151 Ga0496114_1205912 3300048917 Unclassified 643
152 Ga0496115_0908158 3300048918 Unclassified 679
153 Ga0501067_0087143 3300049583 Bacteria 1732
154 Ga0501068_0197948 3300049584 Bacteria 1274
155 Ga0501069_0111556 3300049585 Bacteria 1558
156 Ga0501069_0412805 3300049585 Unclassified 800
157 Ga0501077_0454605 3300049593 Bacteria 820
158 nmdc:mga0qj67_136302_c1 3300050509 Bacteria 1989
159 nmdc:mga06r32_144107_c1 3300050510 Bacteria 2359
160 nmdc:mga06r32_219763_c1 3300050510 Bacteria 1888
161 nmdc:mga08y16_1387123_c1 3300050511 Bacteria 666
162 nmdc:mga0a205_781543_c1 3300050515 Unclassified 803
163 Ga0530510_0284206 3300061734 Bacteria 1236
164 2509147834 2508501128 Bacteria 8613869
165 2799186470 2799112218 Bacteria 4315149
166 Ga0070699_100000701
167 Ga0068869_100982340
168 Ga0070666_11073567
169 Ga0068868_100851080
170 Ga0070692_10020298
171 Ga0070674_100196422
172 Ga0070710_10000050
173 Ga0070708_100909804
174 Ga0070663_101008304
175 Ga0068867_102196298
176 Ga0070685_10156263
177 Ga0070706_100316109
178 Ga0070706_100605869
179 Ga0070707_100439091
180 Ga0070698_101686244
181 Ga0070684_101959573
182 Ga0070696_100010460
183 Ga0070693_100534573
184 Ga0070704_100002378
185 Ga0068859_102385577
186 Ga0068870_10316152
187 Ga0068858_100796939
188 Ga0070715_10506600
189 Ga0097621_100369483
190 Ga0075430_100413114
191 Ga0075431_100108759
192 Ga0075431_100151693
193 Ga0075431_100169082
194 Ga0075433_10491662
195 Ga0097620_102385585
196 Ga0111539_10215168
197 Ga0111539_11219236
198 Ga0105245_10086539
199 Ga0105245_10139356
200 Ga0105245_10198492
201 Ga0105245_10530354
202 Ga0105245_10554842
203 Ga0105245_11185439
204 Ga0105245_12801021
205 Ga0114129_10100208
206 Ga0105243_10443444
207 Ga0105243_10483843
208 Ga0105238_12119190
209 Ga0105239_10244608
210 Ga0105246_11937573
211 Ga0157375_11610554
212 Ga0163163_10702558
213 Ga0163163_10710663
214 Ga0163163_11181337
215 Ga0157380_10531989
216 Ga0157379_10891835
217 Ga0157376_10005699
218 Ga0157376_10523587
219 Ga0182006_1058839
220 Ga0182007_10048656
221 Ga0213872_10059357
222 Ga0213871_10131334
223 Ga0207692_10000022
224 Ga0207685_10365541
225 Ga0207671_10542447
226 Ga0207687_10074360
227 Ga0207687_11570214
228 Ga0207689_10153205
229 Ga0207661_10247801
230 Ga0207661_10493740
231 Ga0207677_10612649
232 Ga0207678_10942395
233 Ga0307408_100983792
234 Ga0307413_10366939
235 Ga0307407_10058560
236 Ga0307415_100264525
237 Ga0373926_0074419
238 Ga0373945_0512371
239 Ga0373960_0174188
240 Ga0373924_0220156
241 Ga0373931_0394821
242 Ga0373927_0002039
243 Ga0373927_0021253
244 Ga0373947_0528656
245 Ga0373937_1015381
246 Ga0373937_1678114
247 Ga0373925_0089757
248 Ga0373925_0269671
249 Ga0373925_1426439
250 Ga0395900_0853856
251 Ga0395905_0125750
252 Ga0436360_1083913
253 Ga0436361_0804016
254 Ga0436361_0919827
255 Ga0451789_0004610
256 Ga0451791_1440202
257 Ga0451793_0557242
258 Ga0451797_0452481
259 Ga0451800_1344417
260 Ga0451807_0194667
261 Ga0451833_0045601
262 Ga0451841_1263702
263 Ga0451845_0137890
264 Ga0451843_0067940
265 Ga0451853_1417811
266 Ga0451853_1997680
267 Ga0466969_0126085
268 Ga0466966_0118089
269 Ga0466966_0575703
270 Ga0466961_0042560
271 Ga0466963_0033278
272 Ga0466970_0066669
273 Ga0466957_0063969
274 Ga0466959_0571961
275 Ga0466967_0044372
276 Ga0466967_0319159
277 Ga0466967_0552024
278 Ga0466967_2297496
279 Ga0466967_2365488
280 Ga0495603_0001284
281 Ga0495653_0132085
282 Ga0495580_0077949
283 Ga0495580_0189362
284 Ga0495582_0161608
285 Ga0495582_0301541
286 Ga0495662_0073792
287 Ga0495664_0315624
288 Ga0495608_0081917
289 Ga0495588_0080785
290 Ga0495647_0165573
291 Ga0495658_0232618
292 Ga0495600_0571027
293 Ga0495581_0152227
294 Ga0496101_0339806
295 Ga0496102_0251486
296 Ga0496102_0738847
297 Ga0496103_0089321
298 Ga0496103_0140661
299 Ga0496105_0112343
300 Ga0496106_0161078
301 Ga0496107_0106524
302 Ga0496108_0002395
303 Ga0496108_0772872
304 Ga0496109_0006153
305 Ga0496109_0907308
306 Ga0496109_1342143
307 Ga0496110_0024168
308 Ga0496110_1771934
309 Ga0496111_0003359
310 Ga0496111_0200267
311 Ga0496112_0286654
312 Ga0496112_0559172
313 Ga0496114_0057500
314 Ga0496114_0093634
315 Ga0496114_0819549
316 Ga0496114_1205912
317 Ga0496115_0908158
318 Ga0501067_0087143
319 Ga0501068_0197948
320 Ga0501069_0111556
321 Ga0501069_0412805
322 Ga0501077_0454605
323 nmdc:mga0qj67_136302_c1
324 nmdc:mga06r32_144107_c1
325 nmdc:mga06r32_219763_c1
326 nmdc:mga08y16_1387123_c1
327 nmdc:mga0a205_781543_c1
328 Ga0530510_0284206
329 2509147834
330 2799186470

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h02-assembly1.cif.gz_A crystal structure of methanohalophilus portucalensis glycine sarcosine n-methyltransferase tetramutant (h21g, e23t, e24n, l28s) 0.723 44 125
4rvh-assembly1.cif.gz_A crystal structure of mtmc in complex with sah and tdp-4-keto-d-olivose 0.7147 12 124
3gwz-assembly1.cif.gz_A structure of the mitomycin 7-o-methyltransferase mmcr 0.7107 44 125
4htf-assembly1.cif.gz_B crystal structure of s-adenosylmethionine-dependent methyltransferase from escherichia coli in complex with s-adenosylmethionine. 0.7105 12 125
5t6b-assembly4.cif.gz_D x-ray structure of the kijd1 c3-methyltransfeerase, converted to monomeric form 0.7095 45 129
ID Description Score Start End Superfamily
af_P9WLG9_29_152_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8112 12 125 3.40.50.150
af_P9WLG9_29_152_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7456 12 125 3.40.50.150
af_P75967_23_215_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7222 42 121 3.40.50.150
af_B0G189_453_564_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7214 94 122 3.30.70.240
af_P9WK97_418_527_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7214 93 126 3.30.70.240
ID Description Score Start End GO Terms
AF-A0A2A5DFH1-F1-model_v4 DUF3052 domain-containing protein 0.956 49 125
AF-A0A386Z7P1-F1-model_v4 DUF3052 domain-containing protein 0.9447 2 129
AF-A0A2N1FAY2-F1-model_v4 DUF3052 domain-containing protein 0.9324 44 129
AF-M6F2I0-F1-model_v4 PF11253 family protein 0.9319 50 125
AF-A0A386Z7P1-F1-model_v4 DUF3052 domain-containing protein 0.9311 2 129

Map