F244297

General Info

Members Datasets Scaffolds Average Seq Length
164 126 328 286

Family's Representative Sequence

Representative Sequence 3300035207|Ga0373942_0004780|Ga0373942_0004780_1561_2610
Length 336
Sequence LRSSRAKKHREASEPNLGTKKHRKLKNQQNFLSFLCFFVAKKAFDAKQRTKVTTGGNMASEALIKVVEQQETLERLSEQIQPVIRDSFKAAGQTGREVKNFLHGTWLGHPLHPALTDVPLGAWTAAFALDAMESISGRRELGSGADVAIAVGLWSETSGRARKVGLLHGVLNVGATALYTTSLVLRRKQKRNAGLGFAMLGYAVSSAAAYLGGHLVFGEQIGVNHAAAQEMPKEFVPVLADADLPEGEMRRADAAGVPVLLVRCEGEVCALAHTCSHLGGPLSEGKLDGDVVQCPWHGSRFNVRDGSVVDGPATFPQPRFETRVREGQIEVRSIDQ

Samples

Sample ID Description Type Environment
1 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
105 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
117 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
118 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
119 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
123 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 2739367866 Hymenobacter sp. YR204 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 0.61
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.83
Rhizosphere 97.56
Stem 0
Stem Tuber 0
Unclassified 21.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373942_0004780 3300035207 Bacteria 3143
2 JGI24751J29686_10000138 3300002459 Bacteria 36181
3 Ga0065714_10064430 3300005288 Bacteria 140636
4 Ga0065712_10000130 3300005290 Bacteria 72641
5 Ga0065715_10091225 3300005293 Bacteria 5982
6 Ga0065715_10117885 3300005293 Unclassified 2333
7 Ga0070683_100149812 3300005329 Unclassified 2212
8 Ga0070670_100000229 3300005331 Bacteria 51545
9 Ga0070680_100356815 3300005336 Bacteria 1243
10 Ga0070660_100445692 3300005339 Bacteria 1074
11 Ga0070689_100018061 3300005340 Bacteria 5189
12 Ga0070675_100461849 3300005354 Bacteria 1140
13 Ga0070659_100229450 3300005366 Unclassified 1534
14 Ga0070701_10000045 3300005438 Bacteria 31796
15 Ga0070705_100224677 3300005440 Unclassified 1302
16 Ga0070700_100033158 3300005441 Unclassified 3109
17 Ga0070700_100158756 3300005441 Bacteria 1554
18 Ga0070708_100003161 3300005445 Bacteria 12837
19 Ga0070681_10016049 3300005458 Bacteria 7464
20 Ga0070681_10054644 3300005458 Bacteria 3979
21 Ga0068867_100504898 3300005459 Unclassified 1040
22 Ga0070706_100000040 3300005467 Bacteria 149660
23 Ga0070707_100137134 3300005468 Bacteria 2380
24 Ga0070698_100348975 3300005471 Unclassified 1411
25 Ga0070679_100078188 3300005530 Bacteria 3297
26 Ga0070695_100013220 3300005545 Bacteria 4959
27 Ga0070693_100044619 3300005547 Bacteria 2508
28 Ga0068855_100120493 3300005563 Bacteria 3003
29 Ga0068855_100128141 3300005563 Unclassified 2900
30 Ga0068854_100325320 3300005578 Unclassified 1251
31 Ga0068854_100466194 3300005578 Bacteria 1058
32 Ga0068856_100090186 3300005614 Unclassified 3049
33 Ga0068859_100093576 3300005617 Bacteria 3057
34 Ga0068864_100097694 3300005618 Bacteria 2600
35 Ga0068858_100620482 3300005842 Bacteria 1050
36 Ga0068860_100350621 3300005843 Bacteria 1453
37 Ga0081455_10048206 3300005937 Bacteria 3683
38 Ga0081538_10012901 3300005981 Bacteria 6661
39 Ga0081538_10018479 3300005981 Bacteria 5233
40 Ga0081539_10000707 3300005985 Bacteria 66881
41 Ga0081539_10013837 3300005985 Bacteria 6038
42 Ga0070717_10000301 3300006028 Bacteria 32522
43 Ga0070716_100060752 3300006173 Unclassified 2184
44 Ga0075430_100078467 3300006846 Unclassified 2768
45 Ga0075430_100461856 3300006846 Unclassified 1048
46 Ga0075431_100083736 3300006847 Bacteria 3293
47 Ga0075431_100098033 3300006847 Bacteria 3027
48 Ga0075431_100164649 3300006847 Bacteria 2280
49 Ga0075433_10022174 3300006852 Bacteria 5330
50 Ga0075433_10084160 3300006852 Unclassified 2807
51 Ga0075433_10494824 3300006852 Unclassified 1076
52 Ga0075434_100352028 3300006871 Bacteria 1494
53 Ga0075429_100089598 3300006880 Bacteria 2682
54 Ga0097620_100093577 3300006931 Bacteria 3057
55 Ga0075435_100059578 3300007076 Bacteria 3095
56 Ga0105251_10069471 3300009011 Bacteria 1642
57 Ga0105245_10000510 3300009098 Bacteria 35697
58 Ga0105247_10292237 3300009101 Unclassified 1128
59 Ga0114129_10060524 3300009147 Bacteria 5295
60 Ga0105242_10010852 3300009176 Bacteria 6996
61 Ga0105248_10065941 3300009177 Bacteria 4065
62 Ga0105248_10105001 3300009177 Bacteria 3185
63 Ga0105248_10306426 3300009177 Bacteria 1789
64 Ga0105248_10669377 3300009177 Bacteria 1171
65 Ga0105237_10099719 3300009545 Bacteria 2896
66 Ga0105238_10328573 3300009551 Bacteria 1516
67 Ga0105249_10531635 3300009553 Bacteria 1224
68 Ga0105239_10035121 3300010375 Bacteria 5506
69 Ga0105246_10026182 3300011119 Unclassified 3807
70 Ga0157373_10006680 3300013100 Bacteria 8592
71 Ga0157373_10331856 3300013100 Bacteria 1083
72 Ga0157371_10022617 3300013102 Bacteria 4602
73 Ga0157371_10053368 3300013102 Bacteria 2870
74 Ga0157371_10265311 3300013102 Bacteria 1238
75 Ga0157370_10001708 3300013104 Bacteria 27039
76 Ga0157370_10241496 3300013104 Bacteria 1671
77 Ga0157369_10482958 3300013105 Bacteria 1282
78 Ga0157378_10000213 3300013297 Bacteria 55959
79 Ga0157378_10000927 3300013297 Bacteria 27015
80 Ga0163162_10008898 3300013306 Bacteria 9765
81 Ga0157372_10026040 3300013307 Bacteria 6362
82 Ga0157372_10459341 3300013307 Bacteria 1484
83 Ga0157375_10028576 3300013308 Bacteria 5231
84 Ga0163163_10003830 3300014325 Bacteria 12806
85 Ga0163163_10333862 3300014325 Bacteria 1571
86 Ga0157379_10691919 3300014968 Unclassified 957
87 Ga0206350_10330432 3300020080 Bacteria 934
88 Ga0207647_10005026 3300025904 Bacteria 9747
89 Ga0207705_10045222 3300025909 Bacteria 3164
90 Ga0207684_10000012 3300025910 Bacteria 478666
91 Ga0207707_10064758 3300025912 Unclassified 3182
92 Ga0207707_10071251 3300025912 Unclassified 3028
93 Ga0207660_10014406 3300025917 Bacteria 5201
94 Ga0207657_10031879 3300025919 Bacteria 4767
95 Ga0207652_10005158 3300025921 Bacteria 10602
96 Ga0207694_10029005 3300025924 Bacteria 4220
97 Ga0207650_10000061 3300025925 Bacteria 149822
98 Ga0207687_10000730 3300025927 Bacteria 22336
99 Ga0207670_10001019 3300025936 Bacteria 14812
100 Ga0207711_10020802 3300025941 Bacteria 5475
101 Ga0207711_10323597 3300025941 Bacteria 1425
102 Ga0207711_10438656 3300025941 Bacteria 1215
103 Ga0207711_10443942 3300025941 Unclassified 1207
104 Ga0207689_10253016 3300025942 Unclassified 1457
105 Ga0207667_10051908 3300025949 Bacteria 4321
106 Ga0207640_10073114 3300025981 Bacteria 2316
107 Ga0207703_10155380 3300026035 Bacteria 1999
108 Ga0207708_10077324 3300026075 Bacteria 2554
109 Ga0207708_10110289 3300026075 Bacteria 2135
110 Ga0207702_10110358 3300026078 Unclassified 2444
111 Ga0207648_10103445 3300026089 Bacteria 2497
112 Ga0207676_10003297 3300026095 Bacteria 11467
113 Ga0207676_10105570 3300026095 Bacteria 2345
114 Ga0207675_100365775 3300026118 Unclassified 1416
115 Ga0268265_10560351 3300028380 Unclassified 1086
116 Ga0268264_10271506 3300028381 Bacteria 1584
117 Ga0307408_100547915 3300031548 Bacteria 1020
118 Ga0307408_100709739 3300031548 Unclassified 905
119 Ga0307413_10418271 3300031824 Unclassified 1055
120 Ga0307406_10192274 3300031901 Bacteria 1495
121 Ga0307406_10259096 3300031901 Bacteria 1315
122 Ga0307406_10339729 3300031901 Bacteria 1169
123 Ga0307409_100012221 3300031995 Bacteria 5460
124 Ga0307409_100055050 3300031995 Bacteria 3069
125 Ga0307416_100357379 3300032002 Bacteria 1481
126 Ga0307411_10036610 3300032005 Bacteria 3077
127 Ga0373946_0086079 3300035171 Bacteria 1385
128 Ga0395899_0004637 3300037312 Bacteria 10717
129 Ga0395899_0112908 3300037312 Bacteria 1952
130 Ga0395900_0008261 3300037418 Bacteria 10717
131 Ga0395900_0057700 3300037418 Unclassified 3997
132 Ga0395898_0008689 3300037466 Bacteria 10717
133 Ga0395898_0379596 3300037466 Bacteria 1348
134 Ga0395898_0437425 3300037466 Bacteria 1246
135 Ga0395905_0089218 3300037471 Bacteria 2890
136 Ga0395901_0017189 3300038443 Bacteria 7379
137 Ga0466963_0280386 3300044694 Bacteria 1171
138 Ga0466957_0198734 3300044842 Unclassified 1316
139 Ga0466967_0087662 3300045976 Bacteria 2822
140 Ga0495641_0042015 3300046461 Bacteria 2121
141 Ga0495639_0044939 3300046475 Bacteria 1998
142 Ga0495665_0027720 3300046531 Bacteria 3039
143 Ga0495640_0021318 3300046533 Bacteria 4758
144 Ga0495658_0091209 3300046683 Bacteria 1804
145 Ga0495613_0173156 3300046689 Bacteria 1531
146 Ga0495674_0031252 3300047319 Bacteria 4838
147 Ga0495676_0126200 3300047321 Bacteria 1854
148 Ga0495679_042063 3300047446 Unclassified 1411
149 Ga0496112_0185510 3300048915 Unclassified 2044
150 Ga0496112_0329138 3300048915 Bacteria 1472
151 Ga0496113_0221827 3300048916 Unclassified 1507
152 Ga0501038_0066590 3300049574 Bacteria 3067
153 Ga0501223_012775 3300049663 Bacteria 1677
154 Ga0501243_004520 3300049675 Bacteria 2088
155 Ga0501083_0260935 3300049744 Bacteria 1127
156 nmdc:mga0qj67_70258_c1 3300050509 Unclassified 2793
157 nmdc:mga06r32_182189_c1 3300050510 Unclassified 2086
158 nmdc:mga06r32_418140_c1 3300050510 Unclassified 1322
159 nmdc:mga0n895_374037_c1 3300050512 Bacteria 1442
160 nmdc:mga0rr50_52461_c1 3300050513 Bacteria 3031
161 nmdc:mga0a205_171288_c1 3300050515 Bacteria 2067
162 Ga0501084_0547659 3300054114 Bacteria 978
163 Ga0501082_0000581 3300060353 Bacteria 32431
164 2740034642 2739367866 Bacteria 4215900
165 Ga0373942_0004780
166 JGI24751J29686_10000138
167 Ga0065714_10064430
168 Ga0065712_10000130
169 Ga0065715_10091225
170 Ga0065715_10117885
171 Ga0070683_100149812
172 Ga0070670_100000229
173 Ga0070680_100356815
174 Ga0070660_100445692
175 Ga0070689_100018061
176 Ga0070675_100461849
177 Ga0070659_100229450
178 Ga0070701_10000045
179 Ga0070705_100224677
180 Ga0070700_100033158
181 Ga0070700_100158756
182 Ga0070708_100003161
183 Ga0070681_10016049
184 Ga0070681_10054644
185 Ga0068867_100504898
186 Ga0070706_100000040
187 Ga0070707_100137134
188 Ga0070698_100348975
189 Ga0070679_100078188
190 Ga0070695_100013220
191 Ga0070693_100044619
192 Ga0068855_100120493
193 Ga0068855_100128141
194 Ga0068854_100325320
195 Ga0068854_100466194
196 Ga0068856_100090186
197 Ga0068859_100093576
198 Ga0068864_100097694
199 Ga0068858_100620482
200 Ga0068860_100350621
201 Ga0081455_10048206
202 Ga0081538_10012901
203 Ga0081538_10018479
204 Ga0081539_10000707
205 Ga0081539_10013837
206 Ga0070717_10000301
207 Ga0070716_100060752
208 Ga0075430_100078467
209 Ga0075430_100461856
210 Ga0075431_100083736
211 Ga0075431_100098033
212 Ga0075431_100164649
213 Ga0075433_10022174
214 Ga0075433_10084160
215 Ga0075433_10494824
216 Ga0075434_100352028
217 Ga0075429_100089598
218 Ga0097620_100093577
219 Ga0075435_100059578
220 Ga0105251_10069471
221 Ga0105245_10000510
222 Ga0105247_10292237
223 Ga0114129_10060524
224 Ga0105242_10010852
225 Ga0105248_10065941
226 Ga0105248_10105001
227 Ga0105248_10306426
228 Ga0105248_10669377
229 Ga0105237_10099719
230 Ga0105238_10328573
231 Ga0105249_10531635
232 Ga0105239_10035121
233 Ga0105246_10026182
234 Ga0157373_10006680
235 Ga0157373_10331856
236 Ga0157371_10022617
237 Ga0157371_10053368
238 Ga0157371_10265311
239 Ga0157370_10001708
240 Ga0157370_10241496
241 Ga0157369_10482958
242 Ga0157378_10000213
243 Ga0157378_10000927
244 Ga0163162_10008898
245 Ga0157372_10026040
246 Ga0157372_10459341
247 Ga0157375_10028576
248 Ga0163163_10003830
249 Ga0163163_10333862
250 Ga0157379_10691919
251 Ga0206350_10330432
252 Ga0207647_10005026
253 Ga0207705_10045222
254 Ga0207684_10000012
255 Ga0207707_10064758
256 Ga0207707_10071251
257 Ga0207660_10014406
258 Ga0207657_10031879
259 Ga0207652_10005158
260 Ga0207694_10029005
261 Ga0207650_10000061
262 Ga0207687_10000730
263 Ga0207670_10001019
264 Ga0207711_10020802
265 Ga0207711_10323597
266 Ga0207711_10438656
267 Ga0207711_10443942
268 Ga0207689_10253016
269 Ga0207667_10051908
270 Ga0207640_10073114
271 Ga0207703_10155380
272 Ga0207708_10077324
273 Ga0207708_10110289
274 Ga0207702_10110358
275 Ga0207648_10103445
276 Ga0207676_10003297
277 Ga0207676_10105570
278 Ga0207675_100365775
279 Ga0268265_10560351
280 Ga0268264_10271506
281 Ga0307408_100547915
282 Ga0307408_100709739
283 Ga0307413_10418271
284 Ga0307406_10192274
285 Ga0307406_10259096
286 Ga0307406_10339729
287 Ga0307409_100012221
288 Ga0307409_100055050
289 Ga0307416_100357379
290 Ga0307411_10036610
291 Ga0373946_0086079
292 Ga0395899_0004637
293 Ga0395899_0112908
294 Ga0395900_0008261
295 Ga0395900_0057700
296 Ga0395898_0008689
297 Ga0395898_0379596
298 Ga0395898_0437425
299 Ga0395905_0089218
300 Ga0395901_0017189
301 Ga0466963_0280386
302 Ga0466957_0198734
303 Ga0466967_0087662
304 Ga0495641_0042015
305 Ga0495639_0044939
306 Ga0495665_0027720
307 Ga0495640_0021318
308 Ga0495658_0091209
309 Ga0495613_0173156
310 Ga0495674_0031252
311 Ga0495676_0126200
312 Ga0495679_042063
313 Ga0496112_0185510
314 Ga0496112_0329138
315 Ga0496113_0221827
316 Ga0501038_0066590
317 Ga0501223_012775
318 Ga0501243_004520
319 Ga0501083_0260935
320 nmdc:mga0qj67_70258_c1
321 nmdc:mga06r32_182189_c1
322 nmdc:mga06r32_418140_c1
323 nmdc:mga0n895_374037_c1
324 nmdc:mga0rr50_52461_c1
325 nmdc:mga0a205_171288_c1
326 Ga0501084_0547659
327 Ga0501082_0000581
328 2740034642

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

234

321

0.94

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

234

332

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.9662 177 276
2yvj-assembly1.cif.gz_B crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex 0.9494 178 275
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.936 177 279
7bui-assembly1.cif.gz_E complex of reduced oxygenase and oxidized ferredoxin in carbazole 1,9a- dioxygenase 0.9301 179 276
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.93 177 276
ID Description Score Start End Superfamily
af_Q9VJ03_9_118_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9631 180 277 2.102.10.10
af_Q19655_23_127_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9526 181 279 2.102.10.10
af_Q58156_13_77_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9401 105 155 1.20.1260.10
5bokA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9361 177 279 2.102.10.10
3dqyA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9324 178 275 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A0S7Z836-F1-model_v4 Rieske domain-containing protein 0.9756 177 279 GO:0005737
GO:0016651
GO:0046872
GO:0051537
AF-A0A537EVX2-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.9754 178 279 GO:0046872
GO:0051537
AF-A0A1Q7IHM7-F1-model_v4 Rieske domain-containing protein 0.9753 178 279 GO:0046872
GO:0051537
AF-A0A2E5Z745-F1-model_v4 Rieske domain-containing protein 0.9752 179 277 GO:0046872
GO:0051537
AF-A0A6A7LL11-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.974 180 275 GO:0046872
GO:0051537

Map