F244190

General Info

Members Datasets Scaffolds Average Seq Length
164 72 163 419

Family's Representative Sequence

Representative Sequence 3300031240|Ga0265320_10001974|Ga0265320_100019743
Length 456
Sequence MFRLPIEFCPSEFWFHPSYFILTGFPVSPHQAFLSMPKVVVTGLGFICPIGNDQATVVNSLRGQRHGLTAYSRFEGPNIPVRVAGLVKDFETESPDPEDWKYPAQYKIKRETLRGFAPHVLFGYCALTQAIADAKLKPEDVSNLDTGMFTASAGSAMMLHHNLSRMEKHGVMKCSPLGIVASVVGTLSYNLVAAFKILGSSCGFASACASSGHALGFAWEEVASGRQKRMLVVGGEDGNLETILPFAGMRALSLNPDPNTASRPFDVARDGFVGAGGACAMVLETDEEAFKRGAPVYCEMPGWGMASDGYNVAISHPDGSGLIQAMRVALRRSGLEPGEVDYINAHATSTPIGDTSELRALKAVFGTNHIDTPAISSTKALTGHGLSLASILEAGFCAAAIKHGFMPGSAHIQNLDPEAAGLDIIRETVNERPHVVMSNSSGFGGANVALVFKSAT

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
22 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
23 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
24 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
25 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
26 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
27 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
28 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
29 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
30 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
31 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
32 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
33 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
34 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
35 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
36 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
37 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
38 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
39 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
40 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
41 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
42 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
43 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
44 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
48 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
49 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
50 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
51 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
52 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
53 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
54 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
55 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
56 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
57 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
58 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
66 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
67 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
68 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
69 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
71 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
72 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 0
Rhizosphere 95.73
Stem 0
Stem Tuber 0
Unclassified 3.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10003035 3300003320 Bacteria 7432
2 rootL2_10009983 3300003322 Bacteria 8278
3 rootL2_10030345 3300003322 Bacteria 8778
4 rootH1_10136808 3300003323 Unclassified 4433
5 Ga0070658_10008206 3300005327 Bacteria 8396
6 Ga0070683_100201216 3300005329 Bacteria 1891
7 Ga0068869_100000882 3300005334 Bacteria 17273
8 Ga0068867_100001654 3300005459 Bacteria 15507
9 Ga0070665_100131312 3300005548 Bacteria 2507
10 Ga0068856_100006540 3300005614 Bacteria 11424
11 Ga0068856_100028128 3300005614 Bacteria 5487
12 Ga0068866_10039841 3300005718 Bacteria 2322
13 Ga0068860_100001950 3300005843 Bacteria 21844
14 Ga0070717_10000015 3300006028 Bacteria 208620
15 Ga0097621_100014570 3300006237 Bacteria 5890
16 Ga0157369_10113473 3300013105 Bacteria 2879
17 Ga0207642_10027459 3300025899 Bacteria 2330
18 Ga0207705_10018238 3300025909 Bacteria 5019
19 Ga0207689_10000039 3300025942 Bacteria 93515
20 Ga0207702_10000352 3300026078 Bacteria 52757
21 Ga0268264_10004832 3300028381 Bacteria 11419
22 Ga0265337_1002439 3300028556 Bacteria 8536
23 Ga0265337_1022653 3300028556 Bacteria 1942
24 Ga0265319_1000113 3300028563 Bacteria 62183
25 Ga0265319_1000702 3300028563 Bacteria 21859
26 Ga0265319_1001216 3300028563 Bacteria 15904
27 Ga0265319_1001433 3300028563 Bacteria 14268
28 Ga0265319_1002961 3300028563 Bacteria 9045
29 Ga0265319_1004194 3300028563 Bacteria 7214
30 Ga0265319_1010892 3300028563 Bacteria 3766
31 Ga0265319_1015425 3300028563 Bacteria 2963
32 Ga0265319_1020013 3300028563 Bacteria 2488
33 Ga0265319_1032173 3300028563 Bacteria 1821
34 Ga0265334_10002631 3300028573 Bacteria 8345
35 Ga0265334_10007840 3300028573 Bacteria 4569
36 Ga0265334_10035254 3300028573 Bacteria 1982
37 Ga0265318_10000055 3300028577 Bacteria 114178
38 Ga0265318_10000425 3300028577 Bacteria 32311
39 Ga0265318_10004180 3300028577 Bacteria 7056
40 Ga0265318_10007191 3300028577 Bacteria 5059
41 Ga0265318_10007474 3300028577 Bacteria 4937
42 Ga0265318_10010370 3300028577 Bacteria 4060
43 Ga0265318_10022021 3300028577 Bacteria 2553
44 Ga0265323_10000005 3300028653 Bacteria 196003
45 Ga0265323_10001806 3300028653 Bacteria 10164
46 Ga0265323_10003691 3300028653 Bacteria 6703
47 Ga0265323_10005106 3300028653 Bacteria 5598
48 Ga0265323_10007536 3300028653 Bacteria 4515
49 Ga0265323_10030090 3300028653 Bacteria 2025
50 Ga0265322_10000526 3300028654 Bacteria 14761
51 Ga0265322_10000994 3300028654 Bacteria 9833
52 Ga0265338_10002495 3300028800 Bacteria 27417
53 Ga0265338_10007935 3300028800 Bacteria 13003
54 Ga0265338_10036930 3300028800 Bacteria 4662
55 Ga0265324_10005331 3300029957 Bacteria 5574
56 Ga0265330_10012056 3300031235 Bacteria 4041
57 Ga0265330_10085112 3300031235 Bacteria 1360
58 Ga0265328_10017710 3300031239 Bacteria 2758
59 Ga0265328_10043714 3300031239 Bacteria 1648
60 Ga0265320_10000014 3300031240 Bacteria 208129
61 Ga0265320_10000359 3300031240 Bacteria 37134
62 Ga0265320_10000468 3300031240 Bacteria 31583
63 Ga0265320_10001974 3300031240 Bacteria 14493
64 Ga0265320_10005194 3300031240 Bacteria 8400
65 Ga0265320_10005450 3300031240 Bacteria 8172
66 Ga0265320_10010064 3300031240 Bacteria 5654
67 Ga0265320_10011243 3300031240 Bacteria 5278
68 Ga0265320_10012218 3300031240 Bacteria 5010
69 Ga0265320_10018730 3300031240 Bacteria 3803
70 Ga0265320_10051066 3300031240 Bacteria 2008
71 Ga0265320_10070202 3300031240 Bacteria 1652
72 Ga0265325_10021325 3300031241 Bacteria 3560
73 Ga0265340_10031454 3300031247 Bacteria 2654
74 Ga0265340_10068394 3300031247 Bacteria 1687
75 Ga0265331_10005227 3300031250 Bacteria 7870
76 Ga0265331_10027363 3300031250 Bacteria 2858
77 Ga0265327_10000063 3300031251 Bacteria 232763
78 Ga0265327_10001497 3300031251 Bacteria 28976
79 Ga0265327_10006891 3300031251 Bacteria 8937
80 Ga0265327_10018050 3300031251 Bacteria 4389
81 Ga0265316_10005918 3300031344 Bacteria 11781
82 Ga0265316_10020980 3300031344 Bacteria 5545
83 Ga0265316_10025980 3300031344 Bacteria 4879
84 Ga0265316_10037301 3300031344 Bacteria 3925
85 Ga0265316_10100450 3300031344 Bacteria 2199
86 Ga0265316_10176008 3300031344 Bacteria 1594
87 Ga0307408_100000011 3300031548 Bacteria 414737
88 Ga0265313_10001076 3300031595 Bacteria 26389
89 Ga0265313_10005943 3300031595 Bacteria 8825
90 Ga0265313_10006480 3300031595 Bacteria 8270
91 Ga0265313_10006528 3300031595 Bacteria 8235
92 Ga0265313_10009263 3300031595 Bacteria 6412
93 Ga0265313_10012395 3300031595 Bacteria 5208
94 Ga0265313_10077067 3300031595 Bacteria 1522
95 Ga0307508_10000006 3300031616 Bacteria 275479
96 Ga0265314_10001472 3300031711 Bacteria 26212
97 Ga0265314_10002389 3300031711 Bacteria 19323
98 Ga0265314_10007703 3300031711 Bacteria 9311
99 Ga0265314_10011195 3300031711 Bacteria 7426
100 Ga0265314_10108918 3300031711 Bacteria 1764
101 Ga0265342_10004887 3300031712 Bacteria 10380
102 Ga0265342_10031398 3300031712 Bacteria 3284
103 Ga0265342_10101190 3300031712 Bacteria 1641
104 Ga0307410_10000004 3300031852 Bacteria 120355
105 Ga0307407_10004640 3300031903 Bacteria 5862
106 Ga0307412_10027948 3300031911 Bacteria 3523
107 Ga0307409_100000138 3300031995 Bacteria 27344
108 Ga0307416_100000035 3300032002 Bacteria 144188
109 Ga0373935_0097822 3300035692 Unclassified 1931
110 Ga0395905_0000026 3300037471 Bacteria 315051
111 Ga0395905_0364837 3300037471 Bacteria 1337
112 Ga0451577_0000059 3300042876 Bacteria 271425
113 Ga0451577_0007015 3300042876 Bacteria 11112
114 Ga0451577_0234613 3300042876 Bacteria 1659
115 Ga0466969_0063107 3300044656 Bacteria 1796
116 Ga0453683_0002395 3300044673 Bacteria 14636
117 Ga0453683_0098990 3300044673 Bacteria 1831
118 Ga0453684_0012444 3300044712 Bacteria 14028
119 Ga0453684_0023159 3300044712 Bacteria 9166
120 Ga0453684_0031832 3300044712 Bacteria 7398
121 Ga0453684_0446419 3300044712 Bacteria 1440
122 Ga0466959_0056377 3300045049 Bacteria 2867
123 Ga0451576_0000182 3300045051 Bacteria 157929
124 Ga0451576_0001663 3300045051 Bacteria 36917
125 Ga0451576_0004063 3300045051 Bacteria 19383
126 Ga0451576_0077885 3300045051 Bacteria 3450
127 Ga0466967_0140478 3300045976 Bacteria 2249
128 Ga0501032_0000356 3300049569 Bacteria 38137
129 Ga0501032_0002303 3300049569 Bacteria 14988
130 Ga0501033_0009033 3300049570 Bacteria 7689
131 Ga0501033_0016803 3300049570 Bacteria 5533
132 Ga0501037_0018428 3300049573 Bacteria 5146
133 Ga0501038_0003970 3300049574 Bacteria 13740
134 Ga0501039_0017910 3300049575 Bacteria 5434
135 Ga0501042_0022184 3300049578 Bacteria 4434
136 Ga0501043_0087886 3300049579 Bacteria 2442
137 Ga0501043_0136026 3300049579 Bacteria 1925
138 Ga0501046_0005708 3300049580 Bacteria 11102
139 Ga0501046_0010683 3300049580 Bacteria 7873
140 Ga0501046_0012812 3300049580 Bacteria 7132
141 Ga0501046_0035891 3300049580 Bacteria 3992
142 Ga0501046_0197811 3300049580 Bacteria 1496
143 Ga0501047_0001300 3300049581 Bacteria 24616
144 Ga0501047_0009855 3300049581 Bacteria 9028
145 Ga0501047_0031620 3300049581 Bacteria 5105
146 Ga0501047_0101655 3300049581 Bacteria 2754
147 Ga0501047_0211846 3300049581 Bacteria 1796
148 Ga0501070_0207620 3300049586 Bacteria 1608
149 Ga0501243_000872 3300049675 Bacteria 4209
150 Ga0501080_0055407 3300049742 Bacteria 3693
151 Ga0501083_0000402 3300049744 Bacteria 27569
152 Ga0501083_0008617 3300049744 Bacteria 7196
153 Ga0501083_0071583 3300049744 Bacteria 2305
154 Ga0501083_0138631 3300049744 Bacteria 1593
155 Ga0501035_0000168 3300049822 Bacteria 80065
156 Ga0501035_0044446 3300049822 Bacteria 4000
157 Ga0501044_0000025 3300049823 Bacteria 187867
158 Ga0501044_0001782 3300049823 Bacteria 25167
159 Ga0501044_0008427 3300049823 Bacteria 11303
160 Ga0501044_0036751 3300049823 Bacteria 5122
161 Ga0501044_0417487 3300049823 Bacteria 1252
162 Ga0500622_0004195 3300053156 Bacteria 9193
163 Ga0466962_0064077 3300061719 Bacteria 1755

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0417487 Ga0501044_0417487_159_1178 339
2 3300003323 rootH1_10136808 rootH1_101368085 395
3 3300028563 Ga0265319_1004194 Ga0265319_10041945 401
4 3300028577 Ga0265318_10010370 Ga0265318_100103703 401
5 3300031240 Ga0265320_10010064 Ga0265320_100100643 401
6 3300028653 Ga0265323_10000005 Ga0265323_1000000557 409
7 3300028654 Ga0265322_10000526 Ga0265322_100005264 409
8 3300031344 Ga0265316_10005918 Ga0265316_100059186 409
9 3300028653 Ga0265323_10007536 Ga0265323_100075362 410
10 3300031595 Ga0265313_10001076 Ga0265313_1000107614 413
11 3300031711 Ga0265314_10002389 Ga0265314_100023899 413
12 iso_pu_bacteria 2786546940 2788434424 415
13 3300003322 rootL2_10030345 rootL2_100303451 417
14 3300044673 Ga0453683_0002395 Ga0453683_0002395_7028_8281 417
15 3300044673 Ga0453683_0098990 Ga0453683_0098990_276_1529 417
16 3300005843 Ga0068860_100001950 Ga0068860_10000195021 418
17 3300028381 Ga0268264_10004832 Ga0268264_100048326 418
18 3300035692 Ga0373935_0097822 Ga0373935_0097822_360_1619 418
19 3300003320 rootH2_10003035 rootH2_100030354 419
20 3300003322 rootL2_10009983 rootL2_100099837 419
21 3300005327 Ga0070658_10008206 Ga0070658_100082064 419
22 3300005329 Ga0070683_100201216 Ga0070683_1002012161 419
23 3300005334 Ga0068869_100000882 Ga0068869_1000008824 419
24 3300005459 Ga0068867_100001654 Ga0068867_1000016544 419
25 3300005548 Ga0070665_100131312 Ga0070665_1001313122 419
26 3300005614 Ga0068856_100006540 Ga0068856_1000065407 419
27 3300005614 Ga0068856_100028128 Ga0068856_1000281286 419
28 3300005718 Ga0068866_10039841 Ga0068866_100398412 419
29 3300006028 Ga0070717_10000015 Ga0070717_10000015151 419
30 3300006237 Ga0097621_100014570 Ga0097621_1000145704 419
31 3300013105 Ga0157369_10113473 Ga0157369_101134733 419
32 3300025899 Ga0207642_10027459 Ga0207642_100274592 419
33 3300025909 Ga0207705_10018238 Ga0207705_100182384 419
34 3300025942 Ga0207689_10000039 Ga0207689_1000003970 419
35 3300026078 Ga0207702_10000352 Ga0207702_1000035214 419
36 3300028556 Ga0265337_1002439 Ga0265337_10024395 419
37 3300028556 Ga0265337_1022653 Ga0265337_10226531 419
38 3300028563 Ga0265319_1000113 Ga0265319_100011318 419
39 3300028563 Ga0265319_1000702 Ga0265319_100070218 419
40 3300028563 Ga0265319_1001216 Ga0265319_10012166 419
41 3300028563 Ga0265319_1001433 Ga0265319_10014338 419
42 3300028563 Ga0265319_1002961 Ga0265319_10029613 419
43 3300028563 Ga0265319_1010892 Ga0265319_10108924 419
44 3300028563 Ga0265319_1015425 Ga0265319_10154252 419
45 3300028563 Ga0265319_1020013 Ga0265319_10200132 419
46 3300028563 Ga0265319_1032173 Ga0265319_10321732 419
47 3300028573 Ga0265334_10002631 Ga0265334_100026315 419
48 3300028573 Ga0265334_10007840 Ga0265334_100078403 419
49 3300028573 Ga0265334_10035254 Ga0265334_100352542 419
50 3300028577 Ga0265318_10000055 Ga0265318_1000005588 419
51 3300028577 Ga0265318_10000425 Ga0265318_100004259 419
52 3300028577 Ga0265318_10004180 Ga0265318_100041804 419
53 3300028577 Ga0265318_10007191 Ga0265318_100071913 419
54 3300028577 Ga0265318_10007474 Ga0265318_100074743 419
55 3300028577 Ga0265318_10022021 Ga0265318_100220213 419
56 3300028653 Ga0265323_10001806 Ga0265323_100018063 419
57 3300028653 Ga0265323_10003691 Ga0265323_100036915 419
58 3300028653 Ga0265323_10005106 Ga0265323_100051062 419
59 3300028653 Ga0265323_10030090 Ga0265323_100300902 419
60 3300028654 Ga0265322_10000994 Ga0265322_100009949 419
61 3300028800 Ga0265338_10002495 Ga0265338_1000249513 419
62 3300028800 Ga0265338_10007935 Ga0265338_100079356 419
63 3300028800 Ga0265338_10036930 Ga0265338_100369303 419
64 3300029957 Ga0265324_10005331 Ga0265324_100053315 419
65 3300031235 Ga0265330_10012056 Ga0265330_100120563 419
66 3300031235 Ga0265330_10085112 Ga0265330_100851121 419
67 3300031239 Ga0265328_10017710 Ga0265328_100177102 419
68 3300031239 Ga0265328_10043714 Ga0265328_100437142 419
69 3300031240 Ga0265320_10000014 Ga0265320_10000014170 419
70 3300031240 Ga0265320_10000359 Ga0265320_1000035929 419
71 3300031240 Ga0265320_10000468 Ga0265320_1000046818 419
72 3300031240 Ga0265320_10001974 Ga0265320_100019743 419
73 3300031240 Ga0265320_10005194 Ga0265320_100051948 419
74 3300031240 Ga0265320_10005450 Ga0265320_100054506 419
75 3300031240 Ga0265320_10011243 Ga0265320_100112435 419
76 3300031240 Ga0265320_10012218 Ga0265320_100122182 419
77 3300031240 Ga0265320_10018730 Ga0265320_100187302 419
78 3300031240 Ga0265320_10051066 Ga0265320_100510662 419
79 3300031240 Ga0265320_10070202 Ga0265320_100702022 419
80 3300031241 Ga0265325_10021325 Ga0265325_100213252 419
81 3300031247 Ga0265340_10031454 Ga0265340_100314542 419
82 3300031247 Ga0265340_10068394 Ga0265340_100683942 419
83 3300031250 Ga0265331_10005227 Ga0265331_100052273 419
84 3300031250 Ga0265331_10027363 Ga0265331_100273633 419
85 3300031251 Ga0265327_10000063 Ga0265327_10000063111 419
86 3300031251 Ga0265327_10001497 Ga0265327_1000149712 419
87 3300031251 Ga0265327_10006891 Ga0265327_100068917 419
88 3300031251 Ga0265327_10018050 Ga0265327_100180503 419
89 3300031344 Ga0265316_10020980 Ga0265316_100209805 419
90 3300031344 Ga0265316_10025980 Ga0265316_100259804 419
91 3300031344 Ga0265316_10037301 Ga0265316_100373012 419
92 3300031344 Ga0265316_10100450 Ga0265316_101004501 419
93 3300031344 Ga0265316_10176008 Ga0265316_101760081 419
94 3300031548 Ga0307408_100000011 Ga0307408_100000011134 419
95 3300031595 Ga0265313_10005943 Ga0265313_100059432 419
96 3300031595 Ga0265313_10006480 Ga0265313_100064802 419
97 3300031595 Ga0265313_10006528 Ga0265313_100065286 419
98 3300031595 Ga0265313_10009263 Ga0265313_100092634 419
99 3300031595 Ga0265313_10012395 Ga0265313_100123952 419
100 3300031595 Ga0265313_10077067 Ga0265313_100770672 419
101 3300031616 Ga0307508_10000006 Ga0307508_10000006123 419
102 3300031711 Ga0265314_10001472 Ga0265314_1000147221 419
103 3300031711 Ga0265314_10007703 Ga0265314_100077037 419
104 3300031711 Ga0265314_10011195 Ga0265314_100111956 419
105 3300031711 Ga0265314_10108918 Ga0265314_101089182 419
106 3300031712 Ga0265342_10004887 Ga0265342_100048877 419
107 3300031712 Ga0265342_10031398 Ga0265342_100313982 419
108 3300031712 Ga0265342_10101190 Ga0265342_101011901 419
109 3300031852 Ga0307410_10000004 Ga0307410_1000000413 419
110 3300031903 Ga0307407_10004640 Ga0307407_100046403 419
111 3300031911 Ga0307412_10027948 Ga0307412_100279482 419
112 3300031995 Ga0307409_100000138 Ga0307409_10000013815 419
113 3300032002 Ga0307416_100000035 Ga0307416_100000035121 419
114 3300037471 Ga0395905_0000026 Ga0395905_0000026_91147_92409 419
115 3300037471 Ga0395905_0364837 Ga0395905_0364837_45_1304 419
116 3300042876 Ga0451577_0000059 Ga0451577_0000059_45735_47003 419
117 3300042876 Ga0451577_0007015 Ga0451577_0007015_4465_5730 419
118 3300042876 Ga0451577_0234613 Ga0451577_0234613_173_1447 419
119 3300044656 Ga0466969_0063107 Ga0466969_0063107_341_1600 419
120 3300044712 Ga0453684_0012444 Ga0453684_0012444_3541_4800 419
121 3300044712 Ga0453684_0023159 Ga0453684_0023159_6556_7818 419
122 3300044712 Ga0453684_0031832 Ga0453684_0031832_4051_5313 419
123 3300044712 Ga0453684_0446419 Ga0453684_0446419_62_1321 419
124 3300045049 Ga0466959_0056377 Ga0466959_0056377_221_1480 419
125 3300045051 Ga0451576_0000182 Ga0451576_0000182_72948_74210 419
126 3300045051 Ga0451576_0001663 Ga0451576_0001663_29904_31163 419
127 3300045051 Ga0451576_0004063 Ga0451576_0004063_2394_3656 419
128 3300045051 Ga0451576_0077885 Ga0451576_0077885_1415_2677 419
129 3300045976 Ga0466967_0140478 Ga0466967_0140478_32_1294 419
130 3300049569 Ga0501032_0000356 Ga0501032_0000356_34181_35443 419
131 3300049569 Ga0501032_0002303 Ga0501032_0002303_3091_4350 419
132 3300049570 Ga0501033_0009033 Ga0501033_0009033_5292_6554 419
133 3300049570 Ga0501033_0016803 Ga0501033_0016803_2564_3826 419
134 3300049573 Ga0501037_0018428 Ga0501037_0018428_2311_3573 419
135 3300049574 Ga0501038_0003970 Ga0501038_0003970_3329_4591 419
136 3300049575 Ga0501039_0017910 Ga0501039_0017910_2006_3268 419
137 3300049578 Ga0501042_0022184 Ga0501042_0022184_1042_2304 419
138 3300049579 Ga0501043_0087886 Ga0501043_0087886_1153_2415 419
139 3300049579 Ga0501043_0136026 Ga0501043_0136026_211_1476 419
140 3300049580 Ga0501046_0005708 Ga0501046_0005708_8450_9712 419
141 3300049580 Ga0501046_0010683 Ga0501046_0010683_6265_7524 419
142 3300049580 Ga0501046_0012812 Ga0501046_0012812_4813_6072 419
143 3300049580 Ga0501046_0035891 Ga0501046_0035891_915_2177 419
144 3300049580 Ga0501046_0197811 Ga0501046_0197811_160_1422 419
145 3300049581 Ga0501047_0001300 Ga0501047_0001300_7589_8848 419
146 3300049581 Ga0501047_0009855 Ga0501047_0009855_1368_2630 419
147 3300049581 Ga0501047_0031620 Ga0501047_0031620_3329_4591 419
148 3300049581 Ga0501047_0101655 Ga0501047_0101655_999_2261 419
149 3300049581 Ga0501047_0211846 Ga0501047_0211846_83_1348 419
150 3300049586 Ga0501070_0207620 Ga0501070_0207620_34_1296 419
151 3300049675 Ga0501243_000872 Ga0501243_000872_2705_3964 419
152 3300049742 Ga0501080_0055407 Ga0501080_0055407_131_1393 419
153 3300049744 Ga0501083_0000402 Ga0501083_0000402_9384_10715 419
154 3300049744 Ga0501083_0008617 Ga0501083_0008617_4818_6080 419
155 3300049744 Ga0501083_0071583 Ga0501083_0071583_60_1322 419
156 3300049744 Ga0501083_0138631 Ga0501083_0138631_294_1556 419
157 3300049822 Ga0501035_0000168 Ga0501035_0000168_68472_69731 419
158 3300049822 Ga0501035_0044446 Ga0501035_0044446_2129_3391 419
159 3300049823 Ga0501044_0000025 Ga0501044_0000025_170850_172109 419
160 3300049823 Ga0501044_0001782 Ga0501044_0001782_9586_10851 419
161 3300049823 Ga0501044_0008427 Ga0501044_0008427_1319_2581 419
162 3300049823 Ga0501044_0036751 Ga0501044_0036751_1070_2332 419
163 3300053156 Ga0500622_0004195 Ga0500622_0004195_7574_8833 419
164 3300061719 Ga0466962_0064077 Ga0466962_0064077_345_1607 419

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02801

Ketoacyl-synt_C

Beta-ketoacyl synthase, C-terminal domain

297

413

0.97

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

36

289

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xox-assembly1.cif.gz_B structure of beta-ketoacyl-acp synthase i (fabb) from vibrio cholerae 0.9655 1 419
2byx-assembly2.cif.gz_D kas i lys328ala mutant in complex with fatty acid 0.9562 1 419
4xox-assembly1.cif.gz_B structure of beta-ketoacyl-acp synthase i (fabb) from vibrio cholerae 0.9561 1 419
2cdh-assembly1.cif.gz_A architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. 0.9559 1 419
2bz4-assembly2.cif.gz_D structure of e.coli kas i h298q mutant 0.9558 1 419
ID Description Score Start End Superfamily
af_I1N0K0_264_378_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9639 265 358 3.40.47.10
1j3nB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.954 271 412 3.40.47.10
4xoxB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9525 269 419 3.40.47.10
1tqyG02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9508 267 417 3.40.47.10
4ewgB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.947 269 419 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A351HBS2-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase 1 (EC 2.3.1.41) (3-oxoacyl-[acyl-carrier-protein] synthase I) (Beta-ketoacyl-ACP synthase I) 0.9783 2 419 GO:0004315
GO:0005829
GO:0006633
AF-A0A351HBS2-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase 1 (EC 2.3.1.41) (3-oxoacyl-[acyl-carrier-protein] synthase I) (Beta-ketoacyl-ACP synthase I) 0.9714 2 419 GO:0004315
GO:0005829
GO:0006633
AF-A0A7W0J1R6-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase II 0.9631 210 419 GO:0004315
GO:0006633
AF-A0A090QPS8-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.179) 0.9625 187 367 GO:0004315
GO:0005829
GO:0006633
AF-A0A3B9LGG8-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase II 0.9617 211 419 GO:0004315
GO:0006633

Feature Viewer

pLDDT pTM Quality
95 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map