F243979

General Info

Members Datasets Scaffolds Average Seq Length
164 132 328 235

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10186538|Ga0163161_101865382
Length 260
Sequence MKFAVVVFPGSNSDYDAFYAASHVVGEQAELIWHKDTDLKGADAVILPGGFAHGDYLRTGAIARFSPIMAAVKAFADRGGPVLGICNGFQVLLEAGLLPGAMVRNDRIKFVSQIVGVRVEQTDTPFTAACTATQVLQLPIAHGEGNYYAPPDVLGEIESNRQVIFRYTSASGETGAQWNPNGSLNSVAGICNKQRNVVGLMPHPERASEASLGSADGRIVLASAVKFFTDVRTSQPQDLKTSRPPAFTETSAGKQDHTRA

Samples

Sample ID Description Type Environment
1 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
67 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
69 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
70 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
71 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
72 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
77 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
78 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
83 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
84 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
87 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
90 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
91 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
92 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
93 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
116 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
126 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
127 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
128 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
129 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
130 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.83
Nodule 0
Rhizoplane 6.1
Rhizosphere 92.07
Stem 0
Stem Tuber 0
Unclassified 1.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163161_10186538 3300017792 Bacteria 1592
2 Ga0068869_100075210 3300005334 Bacteria 2509
3 Ga0070666_10008961 3300005335 Bacteria 6227
4 Ga0070687_100342548 3300005343 Bacteria 962
5 Ga0070661_100346769 3300005344 Bacteria 1164
6 Ga0070692_10513022 3300005345 Bacteria 779
7 Ga0070674_100119325 3300005356 Bacteria 1950
8 Ga0070709_10503562 3300005434 Bacteria 920
9 Ga0070711_100002576 3300005439 Bacteria 10377
10 Ga0070705_100032336 3300005440 Bacteria 2906
11 Ga0070700_100021022 3300005441 Bacteria 3790
12 Ga0070694_100084388 3300005444 Bacteria 2216
13 Ga0070708_100235145 3300005445 Bacteria 1720
14 Ga0070708_100434564 3300005445 Bacteria 1238
15 Ga0070663_100030545 3300005455 Bacteria 3694
16 Ga0070698_100733581 3300005471 Bacteria 931
17 Ga0070699_100000091 3300005518 Bacteria 86800
18 Ga0070699_100007735 3300005518 Bacteria 9342
19 Ga0070672_100007787 3300005543 Bacteria 7307
20 Ga0070696_100001487 3300005546 Bacteria 15345
21 Ga0070693_100196124 3300005547 Bacteria 1309
22 Ga0070704_100050153 3300005549 Bacteria 2932
23 Ga0068852_100153749 3300005616 Bacteria 2142
24 Ga0068860_100326354 3300005843 Bacteria 1507
25 Ga0081455_10004855 3300005937 Bacteria 14918
26 Ga0075428_100172254 3300006844 Bacteria 2346
27 Ga0075430_100100643 3300006846 Bacteria 2413
28 Ga0075434_100268764 3300006871 Bacteria 1725
29 Ga0075429_100034012 3300006880 Bacteria 4428
30 Ga0075429_100448964 3300006880 Bacteria 1130
31 Ga0111539_10010457 3300009094 Bacteria 11679
32 Ga0111539_10239092 3300009094 Bacteria 2114
33 Ga0111539_10536668 3300009094 Bacteria 1363
34 Ga0105247_10062533 3300009101 Bacteria 2310
35 Ga0105242_10526847 3300009176 Bacteria 1128
36 Ga0105237_10095373 3300009545 Bacteria 2964
37 Ga0157372_10191249 3300013307 Bacteria 2371
38 Ga0157375_10033717 3300013308 Bacteria 4869
39 Ga0157380_10003709 3300014326 Bacteria 10500
40 Ga0157380_10053968 3300014326 Bacteria 3188
41 Ga0157379_10037003 3300014968 Bacteria 4351
42 Ga0157379_10776261 3300014968 Bacteria 903
43 Ga0157376_10018024 3300014969 Bacteria 5401
44 Ga0207682_10072951 3300025893 Bacteria 1457
45 Ga0207645_10460934 3300025907 Bacteria 858
46 Ga0207671_10025575 3300025914 Bacteria 4433
47 Ga0207663_10032896 3300025916 Bacteria 3083
48 Ga0207662_10225950 3300025918 Bacteria 1221
49 Ga0207659_10032139 3300025926 Bacteria 3599
50 Ga0207691_10008030 3300025940 Bacteria 10145
51 Ga0207691_10712616 3300025940 Bacteria 846
52 Ga0207689_10090816 3300025942 Bacteria 2509
53 Ga0207651_10153658 3300025960 Bacteria 1795
54 Ga0207703_10234040 3300026035 Bacteria 1648
55 Ga0207678_10034900 3300026067 Bacteria 4380
56 Ga0207678_10552980 3300026067 Bacteria 1007
57 Ga0207708_10035167 3300026075 Bacteria 3813
58 Ga0207702_10230415 3300026078 Bacteria 1731
59 Ga0207648_10025095 3300026089 Bacteria 5314
60 Ga0207698_10142705 3300026142 Bacteria 2066
61 Ga0209966_1013496 3300027695 Bacteria 1513
62 Ga0207428_10000904 3300027907 Bacteria 33138
63 Ga0268265_10145660 3300028380 Bacteria 1990
64 Ga0268264_10158074 3300028381 Bacteria 2039
65 Ga0265319_1049069 3300028563 Bacteria 1399
66 Ga0307405_10526806 3300031731 Bacteria 952
67 Ga0307413_10045319 3300031824 Bacteria 2606
68 Ga0307406_10011515 3300031901 Bacteria 5025
69 Ga0307406_10125439 3300031901 Bacteria 1793
70 Ga0307407_10317281 3300031903 Bacteria 1092
71 Ga0307412_10283380 3300031911 Unclassified 1302
72 Ga0307409_100130961 3300031995 Bacteria 2143
73 Ga0307409_100701308 3300031995 Bacteria 1011
74 Ga0307416_100019910 3300032002 Bacteria 4771
75 Ga0307416_101338222 3300032002 Bacteria 822
76 Ga0307411_10021814 3300032005 Bacteria 3757
77 Ga0307415_100544312 3300032126 Unclassified 1023
78 Ga0373934_0015682 3300035086 Bacteria 2876
79 Ga0373923_0030854 3300035111 Bacteria 2158
80 Ga0373936_0111659 3300035113 Bacteria 1161
81 Ga0373957_0025497 3300035120 Bacteria 2131
82 Ga0373943_0015259 3300035170 Bacteria 3488
83 Ga0373946_0019054 3300035171 Bacteria 2640
84 Ga0373955_0004427 3300035172 Bacteria 6223
85 Ga0373955_0049192 3300035172 Bacteria 2288
86 Ga0373935_0289063 3300035692 Bacteria 1156
87 Ga0373935_0371538 3300035692 Bacteria 1023
88 Ga0373937_0000796 3300036401 Bacteria 27033
89 Ga0373937_0298578 3300036401 Bacteria 1522
90 Ga0373937_0772778 3300036401 Bacteria 908
91 Ga0373925_0014368 3300037068 Bacteria 5728
92 Ga0439461_0035809 3300041410 Bacteria 1054
93 Ga0439433_0016295 3300041999 Bacteria 1646
94 Ga0439434_0025838 3300042435 Bacteria 1773
95 Ga0451577_0002197 3300042876 Bacteria 23772
96 Ga0453684_0000809 3300044712 Bacteria 106510
97 Ga0495592_0100507 3300046454 Bacteria 2062
98 Ga0495592_0263481 3300046454 Bacteria 1134
99 Ga0495653_0276823 3300046463 Bacteria 1103
100 Ga0495653_0346891 3300046463 Bacteria 956
101 Ga0495644_0012212 3300046523 Bacteria 3302
102 Ga0495644_0086512 3300046523 Bacteria 1182
103 Ga0495652_0361964 3300046529 Bacteria 1036
104 Ga0495640_0086596 3300046533 Bacteria 2074
105 Ga0495587_0152580 3300046536 Bacteria 1317
106 Ga0495621_0056948 3300046539 Bacteria 1410
107 Ga0495634_0035964 3300046642 Bacteria 3389
108 Ga0495647_0018539 3300046681 Bacteria 2480
109 Ga0495674_0171883 3300047319 Bacteria 1808
110 Ga0495676_0206019 3300047321 Bacteria 1364
111 Ga0495680_0174591 3300047322 Bacteria 1554
112 Ga0495684_0050120 3300047471 Bacteria 3189
113 Ga0496101_0013188 3300048904 Bacteria 5533
114 Ga0496102_0011065 3300048905 Bacteria 7771
115 Ga0496103_0121742 3300048906 Bacteria 1662
116 Ga0496104_0213328 3300048907 Bacteria 1842
117 Ga0496104_0319974 3300048907 Bacteria 1464
118 Ga0496106_0057026 3300048909 Bacteria 2953
119 Ga0496107_0035399 3300048910 Bacteria 3579
120 Ga0496110_0137052 3300048913 Bacteria 2212
121 Ga0496111_0208599 3300048914 Bacteria 1451
122 Ga0496112_0300370 3300048915 Bacteria 1551
123 Ga0501034_0019424 3300049571 Bacteria 6951
124 Ga0501036_0107632 3300049572 Bacteria 2357
125 Ga0501039_0065836 3300049575 Bacteria 2812
126 Ga0501039_0159951 3300049575 Bacteria 1770
127 Ga0501041_0018535 3300049577 Bacteria 4146
128 Ga0501042_0441561 3300049578 Bacteria 943
129 Ga0501048_0133901 3300049582 Bacteria 1751
130 Ga0501071_0050460 3300049587 Bacteria 2997
131 Ga0501071_0625632 3300049587 Bacteria 828
132 Ga0501071_0681032 3300049587 Bacteria 792
133 Ga0501072_0437250 3300049588 Bacteria 1036
134 Ga0501073_0003486 3300049589 Bacteria 11817
135 Ga0501074_0229942 3300049590 Bacteria 1320
136 Ga0501075_0062065 3300049591 Bacteria 2817
137 Ga0501076_0102718 3300049592 Bacteria 2305
138 Ga0501076_0210542 3300049592 Bacteria 1588
139 Ga0501076_0764300 3300049592 Bacteria 797
140 Ga0501077_0305536 3300049593 Bacteria 1014
141 Ga0501079_0231617 3300049741 Bacteria 1443
142 Ga0501079_0273106 3300049741 Bacteria 1321
143 Ga0501079_0319428 3300049741 Bacteria 1216
144 Ga0501080_0500464 3300049742 Bacteria 1086
145 Ga0501080_0713993 3300049742 Bacteria 883
146 Ga0501081_0098154 3300049743 Bacteria 2068
147 Ga0501044_0011545 3300049823 Bacteria 9572
148 Ga0501045_0024941 3300049824 Bacteria 4296
149 Ga0501045_0071375 3300049824 Bacteria 2556
150 nmdc:mga05p37_90396_c1 3300050507 Bacteria 3773
151 nmdc:mga09592_54375_c1 3300050508 Bacteria 3382
152 nmdc:mga08y16_110041_c1 3300050511 Bacteria 2869
153 nmdc:mga08y16_245707_c1 3300050511 Bacteria 1849
154 nmdc:mga08y16_846024_c1 3300050511 Bacteria 904
155 nmdc:mga0n895_13733_c1 3300050512 Bacteria 7322
156 Ga0495601_0041594 3300053077 Bacteria 2881
157 Ga0495595_0018046 3300053084 Bacteria 3044
158 Ga0495619_0080570 3300053085 Bacteria 2191
159 Ga0495619_0105278 3300053085 Bacteria 1923
160 Ga0500555_000987 3300053103 Bacteria 9742
161 Ga0500616_0000595 3300053153 Bacteria 43987
162 Ga0500645_001440 3300053730 Bacteria 12060
163 Ga0501082_0070970 3300060353 Bacteria 2999
164 Ga0530510_0240711 3300061734 Bacteria 1347
165 Ga0163161_10186538
166 Ga0068869_100075210
167 Ga0070666_10008961
168 Ga0070687_100342548
169 Ga0070661_100346769
170 Ga0070692_10513022
171 Ga0070674_100119325
172 Ga0070709_10503562
173 Ga0070711_100002576
174 Ga0070705_100032336
175 Ga0070700_100021022
176 Ga0070694_100084388
177 Ga0070708_100235145
178 Ga0070708_100434564
179 Ga0070663_100030545
180 Ga0070698_100733581
181 Ga0070699_100000091
182 Ga0070699_100007735
183 Ga0070672_100007787
184 Ga0070696_100001487
185 Ga0070693_100196124
186 Ga0070704_100050153
187 Ga0068852_100153749
188 Ga0068860_100326354
189 Ga0081455_10004855
190 Ga0075428_100172254
191 Ga0075430_100100643
192 Ga0075434_100268764
193 Ga0075429_100034012
194 Ga0075429_100448964
195 Ga0111539_10010457
196 Ga0111539_10239092
197 Ga0111539_10536668
198 Ga0105247_10062533
199 Ga0105242_10526847
200 Ga0105237_10095373
201 Ga0157372_10191249
202 Ga0157375_10033717
203 Ga0157380_10003709
204 Ga0157380_10053968
205 Ga0157379_10037003
206 Ga0157379_10776261
207 Ga0157376_10018024
208 Ga0207682_10072951
209 Ga0207645_10460934
210 Ga0207671_10025575
211 Ga0207663_10032896
212 Ga0207662_10225950
213 Ga0207659_10032139
214 Ga0207691_10008030
215 Ga0207691_10712616
216 Ga0207689_10090816
217 Ga0207651_10153658
218 Ga0207703_10234040
219 Ga0207678_10034900
220 Ga0207678_10552980
221 Ga0207708_10035167
222 Ga0207702_10230415
223 Ga0207648_10025095
224 Ga0207698_10142705
225 Ga0209966_1013496
226 Ga0207428_10000904
227 Ga0268265_10145660
228 Ga0268264_10158074
229 Ga0265319_1049069
230 Ga0307405_10526806
231 Ga0307413_10045319
232 Ga0307406_10011515
233 Ga0307406_10125439
234 Ga0307407_10317281
235 Ga0307412_10283380
236 Ga0307409_100130961
237 Ga0307409_100701308
238 Ga0307416_100019910
239 Ga0307416_101338222
240 Ga0307411_10021814
241 Ga0307415_100544312
242 Ga0373934_0015682
243 Ga0373923_0030854
244 Ga0373936_0111659
245 Ga0373957_0025497
246 Ga0373943_0015259
247 Ga0373946_0019054
248 Ga0373955_0004427
249 Ga0373955_0049192
250 Ga0373935_0289063
251 Ga0373935_0371538
252 Ga0373937_0000796
253 Ga0373937_0298578
254 Ga0373937_0772778
255 Ga0373925_0014368
256 Ga0439461_0035809
257 Ga0439433_0016295
258 Ga0439434_0025838
259 Ga0451577_0002197
260 Ga0453684_0000809
261 Ga0495592_0100507
262 Ga0495592_0263481
263 Ga0495653_0276823
264 Ga0495653_0346891
265 Ga0495644_0012212
266 Ga0495644_0086512
267 Ga0495652_0361964
268 Ga0495640_0086596
269 Ga0495587_0152580
270 Ga0495621_0056948
271 Ga0495634_0035964
272 Ga0495647_0018539
273 Ga0495674_0171883
274 Ga0495676_0206019
275 Ga0495680_0174591
276 Ga0495684_0050120
277 Ga0496101_0013188
278 Ga0496102_0011065
279 Ga0496103_0121742
280 Ga0496104_0213328
281 Ga0496104_0319974
282 Ga0496106_0057026
283 Ga0496107_0035399
284 Ga0496110_0137052
285 Ga0496111_0208599
286 Ga0496112_0300370
287 Ga0501034_0019424
288 Ga0501036_0107632
289 Ga0501039_0065836
290 Ga0501039_0159951
291 Ga0501041_0018535
292 Ga0501042_0441561
293 Ga0501048_0133901
294 Ga0501071_0050460
295 Ga0501071_0625632
296 Ga0501071_0681032
297 Ga0501072_0437250
298 Ga0501073_0003486
299 Ga0501074_0229942
300 Ga0501075_0062065
301 Ga0501076_0102718
302 Ga0501076_0210542
303 Ga0501076_0764300
304 Ga0501077_0305536
305 Ga0501079_0231617
306 Ga0501079_0273106
307 Ga0501079_0319428
308 Ga0501080_0500464
309 Ga0501080_0713993
310 Ga0501081_0098154
311 Ga0501044_0011545
312 Ga0501045_0024941
313 Ga0501045_0071375
314 nmdc:mga05p37_90396_c1
315 nmdc:mga09592_54375_c1
316 nmdc:mga08y16_110041_c1
317 nmdc:mga08y16_245707_c1
318 nmdc:mga08y16_846024_c1
319 nmdc:mga0n895_13733_c1
320 Ga0495601_0041594
321 Ga0495595_0018046
322 Ga0495619_0080570
323 Ga0495619_0105278
324 Ga0500555_000987
325 Ga0500616_0000595
326 Ga0500645_001440
327 Ga0501082_0070970
328 Ga0530510_0240711

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13507

GATase_5

CobB/CobQ-like glutamine amidotransferase domain

1

228

0.9

PF01965

DJ-1_PfpI

DJ-1/PfpI family

22

104

0.88

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

5

141

0.87

PF00117

GATase

Glutamine amidotransferase class-I

18

214

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9286 2 228
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9076 2 228
6lyk-assembly1.cif.gz_A crystal structure of r1263a mutant of formylglycinamidine synthetase 0.874 2 205
1t3t-assembly1.cif.gz_A structure of formylglycinamide synthetase 0.8706 2 224
6lyo-assembly1.cif.gz_A crystal structure of h296a mutant of formylglycinamidine synthetase 0.8702 2 215
ID Description Score Start End Superfamily
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9572 1 229 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9527 2 228 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9522 1 228 3.40.50.880
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9491 1 229 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9438 1 228 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A534TEH8-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ 0.9982 1 47
AF-A0A2V8RZ66-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9824 79 203 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-X1CA12-F1-model_v4 Uncharacterized protein 0.9794 80 220 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A6J6JNV2-F1-model_v4 Unannotated protein 0.9776 69 226 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A534TEH8-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ 0.9776 1 47

Map