F242654

General Info

Members Datasets Scaffolds Average Seq Length
163 120 137 1119

Family's Representative Sequence

Representative Sequence 3300053086|Ga0500578_0001284|Ga0500578_0001284_11959_15585
Length 1193
Sequence LNRRPCYSIVTANSIVHQPKLSQTWERPDFLPYSLTARKRKPEALERNRPNLGKLSKSVETVICLPNFKSMIFTNLYQAVRIPQRVKSKTILVMKLTAVFILAGFLQVSAAGFSQTVTVNKENIPLQKLFREIKKQTGYVFFYNMRLLQKTHPVNIDVQNKGLKEVLDLVFAEQPVTYSIVNKTVVVNDRVAVPVPAEIKQVDTVPAVEIHGQVIDAVSGTPVVGGNVLIKGSKIGTVTDGSGNFVIRAKPGTRLVISYVGFENIEVVAKDGKLSVKLKPNKDPLTDVVITGYQQIKKESFTGNAVTVTGEELKRINPTNMLQSIQAYDPSFQVAQNNLLGSNPNSLPRVNVRGSASLPTGSSDFILDGFEVSVEKVFDLDVNRVQTITLLKDAAATAVYGSRAANGVLVITTKAPQEGKLQLNYSYDGTVSAPDLTAYHVLDAAQKLEYERLAGLYLPVADRTKDEQEELYYQKKANVVSGVNTYWLSQPVTTAMGHKNSLYLEGGNSSIRYGLDLRYQTQPGVMKGSGRDRYGVGSVLSYSPNKKFIFRNTLSITQVTGKESPYGSFSTFVAMNPYYPKTDSAGHIIQVVDSWIVDTKLSDSSQFKTTNVLNPMYDGTLSSFNRTKYTEIIDAFTADWSLTSALRLRGLASVTKRKYTTDVFQSPLSNQFFNYSSDRLKERGSYIYATSDENIFDGNITMNYNKVLLGEHFINLAAGVNMRTASSDTRAISAVGFSNDRFTSIAFANSYAPNSHPDASYSLERLFGSFLSLNYSYRNKYLLDLSARLDGSSKFGNENKTAPFWSVGVGWNVHKEDFLLNSAISTLKLRASTGITGQVNFQPYQSKTTYDYYTNSWYSTGIGAAVTTYGNEGLKWQKTDNYEVGMDVGLFRDRLFIATRYYQKLTHGLLADIILPPSTGFSSYKENLGDMRNTGVEMNLKATVYKDRNWTVSLTANMSRNENKIVRISNALKSYNDKIDDEQEKDYKGTPLLRYNEGQSLNTIYAVHSMGIDPENGKEIYIKRDGSLTYTWDVKDVVPVADNTPTAYGYFGPNIAYKRFMLNVLFYTKFGGKEYNQTLVDRIENANPRYNVDSRVLSDRWKKPGDKALYKDITSTDITYVSDRFIQKDNVLELSSVYLSYDFEKRFYSKLAMRNLRVAFTMNDVWHWSTMKQERGIDYPFARSFTFSIQTSL

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2738541283 Pedobacter sp. OK701 Isolate Unclassified
3 2738541302 Pedobacter sp. CF074 Isolate Unclassified
4 2738543023 Pedobacter sp. OK628 Isolate Unclassified
5 2739367651 Pedobacter sp. OK291 Isolate Unclassified
6 2739367656 Pedobacter sp. CF523 Isolate Unclassified
7 2818991437 Pedobacter terrae 518 Isolate Unclassified
8 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
9 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
10 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
11 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
12 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
13 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
14 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
15 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
16 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
17 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
18 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
19 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
20 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
21 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
22 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
23 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
24 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
25 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
26 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
27 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
28 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
29 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
95 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
96 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
97 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
98 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
99 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
102 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
103 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
104 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
105 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
112 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
113 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
114 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
115 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
116 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
117 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
118 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
119 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
120 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.44
Metatranscriptomes 0
Isolates 16.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.79
Nodule 0
Rhizoplane 0
Rhizosphere 60.74
Stem 0
Stem Tuber 0
Unclassified 21.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001677 3300002773 Bacteria 9172
2 JGI25150J39212_1000027 3300002774 Bacteria 106080
3 JGI25151J46595_10000120 3300003187 Bacteria 106401
4 JGI25153J46596_10000090 3300003215 Bacteria 106197
5 rootH1_10130744 3300003316 Bacteria 6302
6 rootH2_10012319 3300003320 Bacteria 43351
7 rootH2_10035103 3300003320 Bacteria 20024
8 rootL2_10121512 3300003322 Bacteria 7938
9 rootH1_10017724 3300003316 Bacteria 7777
10 rootH1_10017724 3300003323 Bacteria 61177
11 rootH1_10028743 3300003323 Bacteria 10631
12 rootH1_10032632 3300003323 Bacteria 15899
13 rootH1_10180813 3300003323 Bacteria 14325
14 Ga0055536_1000052 3300003781 Bacteria 111581
15 Ga0055536_1000068 3300003781 Bacteria 96642
16 Ga0055530_10000684 3300003791 Bacteria 28727
17 Ga0055531_10000872 3300003794 Bacteria 24730
18 Ga0065165_1002118 3300005262 Bacteria 18084
19 Ga0065714_10002208 3300005288 Bacteria 53553
20 Ga0065714_10002354 3300005288 Bacteria 44650
21 Ga0065704_10070212 3300005289 Bacteria 71637
22 Ga0070662_100000845 3300005457 Bacteria 18821
23 Ga0070665_100000041 3300005548 Bacteria 297849
24 Ga0068854_100015365 3300005578 Bacteria 5070
25 Ga0068860_100006462 3300005843 Bacteria 11770
26 Ga0105240_10000396 3300009093 Bacteria 81252
27 Ga0105240_10000998 3300009093 Bacteria 50528
28 Ga0105240_10001864 3300009093 Bacteria 35166
29 Ga0105240_10008415 3300009093 Bacteria 14761
30 Ga0105240_10012466 3300009093 Bacteria 11729
31 Ga0105241_10003048 3300009174 Bacteria 12499
32 Ga0105237_10000052 3300009545 Bacteria 160459
33 Ga0105237_10001212 3300009545 Bacteria 34468
34 Ga0105237_10001779 3300009545 Bacteria 27854
35 Ga0105237_10002292 3300009545 Bacteria 23786
36 Ga0105237_10004181 3300009545 Bacteria 16811
37 Ga0105237_10022394 3300009545 Bacteria 6483
38 Ga0105238_10000790 3300009551 Bacteria 32827
39 Ga0105238_10002759 3300009551 Bacteria 17517
40 Ga0105239_10000896 3300010375 Bacteria 42315
41 Ga0105239_10001754 3300010375 Bacteria 28593
42 Ga0105239_10004558 3300010375 Bacteria 16516
43 Ga0105239_10011771 3300010375 Bacteria 9764
44 Ga0105239_10019680 3300010375 Bacteria 7450
45 Ga0157371_10000009 3300013102 Bacteria 392895
46 Ga0157370_10003580 3300013104 Bacteria 18172
47 Ga0157370_10013333 3300013104 Bacteria 8466
48 Ga0157369_10000006 3300013105 Bacteria 412230
49 Ga0157369_10002353 3300013105 Bacteria 22741
50 Ga0157369_10010399 3300013105 Bacteria 10605
51 Ga0157374_10000366 3300013296 Bacteria 41686
52 Ga0163162_10000304 3300013306 Bacteria 45418
53 Ga0163162_10001715 3300013306 Bacteria 20533
54 Ga0157372_10000894 3300013307 Bacteria 32388
55 Ga0157372_10041334 3300013307 Bacteria 5098
56 Ga0182006_1000113 3300015261 Bacteria 86691
57 Ga0182006_1000120 3300015261 Bacteria 84872
58 Ga0182006_1000321 3300015261 Bacteria 41748
59 Ga0182007_10000122 3300015262 Bacteria 54069
60 Ga0182005_1000073 3300015265 Bacteria 80498
61 Ga0163161_10000089 3300017792 Bacteria 91093
62 Ga0209436_102692 3300025208 Bacteria 5139
63 Ga0209258_100032 3300025242 Bacteria 452764
64 Ga0207425_1000004 3300025245 Bacteria 1092421
65 Ga0209148_1000186 3300025254 Bacteria 117677
66 Ga0209129_1000048 3300025258 Bacteria 270192
67 Ga0209233_1001073 3300025261 Bacteria 11314
68 Ga0209676_1000090 3300025292 Bacteria 256336
69 Ga0209025_1000009 3300025294 Bacteria 1092561
70 Ga0209758_1000010 3300025297 Bacteria 1092782
71 Ga0209050_1000091 3300025298 Bacteria 253049
72 Ga0209257_1000233 3300025304 Bacteria 129948
73 Ga0207647_10000027 3300025904 Bacteria 109872
74 Ga0207695_10000031 3300025913 Bacteria 526801
75 Ga0207695_10000055 3300025913 Bacteria 382776
76 Ga0207695_10001344 3300025913 Bacteria 41706
77 Ga0207671_10000974 3300025914 Bacteria 35495
78 Ga0207671_10001966 3300025914 Bacteria 22674
79 Ga0207671_10002972 3300025914 Bacteria 17414
80 Ga0207671_10003471 3300025914 Bacteria 15685
81 Ga0207671_10003615 3300025914 Bacteria 15272
82 Ga0207671_10009144 3300025914 Bacteria 8315
83 Ga0207694_10005846 3300025924 Bacteria 9426
84 Ga0207706_10000010 3300025933 Bacteria 200039
85 Ga0207667_10003062 3300025949 Bacteria 20722
86 Ga0207674_10006611 3300026116 Bacteria 13626
87 Ga0268266_10000014 3300028379 Bacteria 644033
88 Ga0268264_10000327 3300028381 Bacteria 75326
89 Ga0268264_10003965 3300028381 Bacteria 12669
90 Ga0307515_10001717 3300028794 Bacteria 48771
91 Ga0307515_10008026 3300028794 Bacteria 20699
92 Ga0307513_10014702 3300031456 Bacteria 9524
93 Ga0307405_10000018 3300031731 Bacteria 182495
94 Ga0307407_10000015 3300031903 Bacteria 143258
95 Ga0307416_100000025 3300032002 Bacteria 178154
96 Ga0307414_10002858 3300032004 Bacteria 9120
97 Ga0307510_10005986 3300033180 Bacteria 14516
98 Ga0395899_0000001 3300037312 Bacteria 1750322
99 Ga0466969_0001424 3300044656 Bacteria 12906
100 Ga0466972_0000304 3300044658 Bacteria 29095
101 Ga0466972_0005920 3300044658 Bacteria 6135
102 Ga0466966_0007949 3300044684 Bacteria 7026
103 Ga0466957_0002262 3300044842 Bacteria 10316
104 Ga0466959_0000029 3300045049 Bacteria 112104
105 Ga0466959_0018333 3300045049 Bacteria 5139
106 Ga0495585_0000688 3300046492 Bacteria 30743
107 Ga0495610_0000047 3300046512 Bacteria 151516
108 Ga0495610_0001003 3300046512 Bacteria 26025
109 Ga0495648_0000232 3300046524 Bacteria 64041
110 Ga0495648_0003806 3300046524 Bacteria 13107
111 Ga0495633_0000219 3300046558 Bacteria 70928
112 Ga0495668_0000044 3300046616 Bacteria 227585
113 Ga0495668_0001947 3300046616 Bacteria 18343
114 Ga0495611_0001388 3300046648 Bacteria 12117
115 Ga0495625_0000607 3300046660 Bacteria 52064
116 Ga0495687_000144 3300047443 Bacteria 108217
117 Ga0496117_0002726 3300048920 Bacteria 21693
118 Ga0496121_0000007 3300048924 Bacteria 942516
119 Ga0496122_0000782 3300048925 Bacteria 61189
120 Ga0496122_0003931 3300048925 Bacteria 18999
121 Ga0496123_0004532 3300048926 Bacteria 14515
122 Ga0496123_0017735 3300048926 Bacteria 5708
123 Ga0496126_0018729 3300048929 Bacteria 6850
124 Ga0501300_000382 3300049523 Bacteria 6791
125 Ga0501047_0032030 3300049581 Bacteria 5073
126 Ga0501219_000119 3300049703 Bacteria 13874
127 Ga0501044_0001399 3300049823 Bacteria 28286
128 Ga0501284_00020 3300050005 Bacteria 91754
129 nmdc:mga0k408_1170_c1 3300050493 Bacteria 14351
130 Ga0500578_0001284 3300053086 Bacteria 25969
131 Ga0500644_0000077 3300053088 Bacteria 59580
132 Ga0500569_000122 3300053109 Bacteria 12100
133 Ga0500618_000009 3300053125 Bacteria 209970
134 Ga0500658_0001515 3300053134 Bacteria 9313
135 Ga0500577_0000218 3300053142 Bacteria 15217
136 Ga0500622_0003686 3300053156 Bacteria 10053
137 Ga0500636_0005562 3300053177 Bacteria 7196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049523 Ga0501300_000382 Ga0501300_000382_3796_6780 948
2 3300025208 Ga0209436_102692 Ga0209436_1026923 1031
3 3300013105 Ga0157369_10002353 Ga0157369_1000235314 1033
4 3300025261 Ga0209233_1001073 Ga0209233_10010736 1034
5 3300050493 nmdc:mga0k408_1170_c1 nmdc:mga0k408_1170_c1_2825_6163 1046
6 3300013306 Ga0163162_10000304 Ga0163162_100003042 1054
7 3300028794 Ga0307515_10008026 Ga0307515_100080264 1055
8 3300003781 Ga0055536_1000052 Ga0055536_10000521 1056
9 3300003781 Ga0055536_1000068 Ga0055536_100006848 1056
10 3300003791 Ga0055530_10000684 Ga0055530_1000068416 1056
11 3300025292 Ga0209676_1000090 Ga0209676_1000090174 1056
12 3300025298 Ga0209050_1000091 Ga0209050_1000091175 1056
13 3300048929 Ga0496126_0018729 Ga0496126_0018729_1755_5201 1058
14 3300046558 Ga0495633_0000219 Ga0495633_0000219_44902_48261 1060
15 3300048920 Ga0496117_0002726 Ga0496117_0002726_2679_6050 1062
16 3300048925 Ga0496122_0003931 Ga0496122_0003931_11703_15074 1062
17 3300048926 Ga0496123_0017735 Ga0496123_0017735_179_3550 1062
18 3300015265 Ga0182005_1000073 Ga0182005_100007327 1064
19 3300005289 Ga0065704_10070212 Ga0065704_1007021219 1065
20 3300046492 Ga0495585_0000688 Ga0495585_0000688_22614_25955 1065
21 3300046524 Ga0495648_0000232 Ga0495648_0000232_20139_23480 1065
22 3300046660 Ga0495625_0000607 Ga0495625_0000607_42984_46325 1065
23 3300013102 Ga0157371_10000009 Ga0157371_1000000926 1067
24 3300010375 Ga0105239_10011771 Ga0105239_100117714 1068
25 3300015261 Ga0182006_1000120 Ga0182006_100012052 1069
26 3300025914 Ga0207671_10003471 Ga0207671_1000347111 1069
27 3300028794 Ga0307515_10001717 Ga0307515_100017173 1069
28 3300046648 Ga0495611_0001388 Ga0495611_0001388_7204_10635 1069
29 3300003323 rootH1_10032632 rootH1_1003263213 1071
30 3300013105 Ga0157369_10000006 Ga0157369_1000000652 1071
31 3300015261 Ga0182006_1000113 Ga0182006_10001139 1071
32 3300015262 Ga0182007_10000122 Ga0182007_100001229 1071
33 3300015261 Ga0182006_1000321 Ga0182006_10003217 1072
34 3300005578 Ga0068854_100015365 Ga0068854_1000153652 1075
35 3300003320 rootH2_10035103 rootH2_1003510312 1076
36 3300009093 Ga0105240_10000396 Ga0105240_100003963 1076
37 3300025913 Ga0207695_10000031 Ga0207695_10000031265 1076
38 3300053088 Ga0500644_0000077 Ga0500644_0000077_50243_53659 1076
39 3300053109 Ga0500569_000122 Ga0500569_000122_2478_5918 1078
40 3300053134 Ga0500658_0001515 Ga0500658_0001515_2947_6387 1078
41 3300053142 Ga0500577_0000218 Ga0500577_0000218_6567_10007 1078
42 iso_pu_bacteria 2818991442 2819573110 1078
43 iso_pu_bacteria 2821136567 2821139441 1078
44 iso_pu_bacteria 2904467357 2904471927 1078
45 3300010375 Ga0105239_10000896 Ga0105239_1000089611 1079
46 iso_pu_bacteria 2904780799 2904781272 1079
47 iso_pu_bacteria 2919177583 2919178876 1079
48 3300005288 Ga0065714_10002354 Ga0065714_100023549 1080
49 3300009545 Ga0105237_10001779 Ga0105237_1000177917 1080
50 3300013104 Ga0157370_10013333 Ga0157370_100133338 1080
51 3300025914 Ga0207671_10009144 Ga0207671_100091444 1080
52 3300025949 Ga0207667_10003062 Ga0207667_100030629 1080
53 3300026116 Ga0207674_10006611 Ga0207674_100066113 1080
54 3300048925 Ga0496122_0000782 Ga0496122_0000782_14997_18404 1080
55 3300048926 Ga0496123_0004532 Ga0496123_0004532_10980_14387 1080
56 3300003316 rootH1_10130744 rootH1_101307442 1081
57 3300031903 Ga0307407_10000015 Ga0307407_1000001551 1081
58 3300032002 Ga0307416_100000025 Ga0307416_10000002551 1081
59 3300005288 Ga0065714_10002208 Ga0065714_1000220839 1082
60 3300017792 Ga0163161_10000089 Ga0163161_1000008957 1082
61 3300031731 Ga0307405_10000018 Ga0307405_1000001855 1082
62 3300044842 Ga0466957_0002262 Ga0466957_0002262_2492_5848 1086
63 3300045049 Ga0466959_0018333 Ga0466959_0018333_748_4212 1086
64 iso_pu_bacteria 2896344016 2896346247 1086
65 3300049581 Ga0501047_0032030 Ga0501047_0032030_1361_4774 1087
66 iso_pu_bacteria 2842722452 2842723447 1087
67 iso_pu_bacteria 2842909656 2842909955 1087
68 iso_pu_bacteria 2849281842 2849284800 1087
69 3300031456 Ga0307513_10014702 Ga0307513_100147025 1088
70 3300046512 Ga0495610_0001003 Ga0495610_0001003_16354_19713 1088
71 3300049703 Ga0501219_000119 Ga0501219_000119_7177_10596 1088
72 3300050005 Ga0501284_00020 Ga0501284_00020_57219_60638 1088
73 3300053086 Ga0500578_0001284 Ga0500578_0001284_11959_15585 1088
74 3300053177 Ga0500636_0005562 Ga0500636_0005562_760_4176 1088
75 iso_pu_bacteria 2919692658 2919696976 1088
76 iso_pu_bacteria 2738541278 2738726764 1089
77 3300003323 rootH1_10028743 rootH1_100287434 1090
78 3300010375 Ga0105239_10019680 Ga0105239_100196802 1090
79 iso_pu_bacteria 2929239360 2929240424 1090
80 3300003794 Ga0055531_10000872 Ga0055531_1000087222 1091
81 3300005843 Ga0068860_100006462 Ga0068860_1000064625 1091
82 3300009093 Ga0105240_10008415 Ga0105240_100084152 1091
83 3300009093 Ga0105240_10012466 Ga0105240_100124662 1091
84 3300009545 Ga0105237_10002292 Ga0105237_1000229217 1091
85 3300009545 Ga0105237_10004181 Ga0105237_1000418112 1091
86 3300009551 Ga0105238_10002759 Ga0105238_100027594 1091
87 3300010375 Ga0105239_10001754 Ga0105239_1000175413 1091
88 3300013104 Ga0157370_10003580 Ga0157370_100035807 1091
89 3300013105 Ga0157369_10010399 Ga0157369_100103995 1091
90 3300013307 Ga0157372_10000894 Ga0157372_1000089416 1091
91 3300025304 Ga0209257_1000233 Ga0209257_100023356 1091
92 3300025914 Ga0207671_10003615 Ga0207671_100036155 1091
93 3300028381 Ga0268264_10003965 Ga0268264_100039656 1091
94 iso_pu_bacteria 2896317667 2896319036 1091
95 3300005262 Ga0065165_1002118 Ga0065165_10021185 1092
96 3300025242 Ga0209258_100032 Ga0209258_100032178 1092
97 3300025254 Ga0209148_1000186 Ga0209148_100018653 1092
98 3300046616 Ga0495668_0001947 Ga0495668_0001947_2785_6207 1092
99 3300009545 Ga0105237_10000052 Ga0105237_1000005237 1094
100 3300025914 Ga0207671_10000974 Ga0207671_1000097425 1094
101 3300033180 Ga0307510_10005986 Ga0307510_100059866 1094
102 3300046524 Ga0495648_0003806 Ga0495648_0003806_5582_9019 1094
103 3300046616 Ga0495668_0000044 Ga0495668_0000044_119755_123192 1094
104 3300003323 rootH1_10017724 rootH1_1001772423 1096
105 3300003323 rootH1_10180813 rootH1_101808139 1096
106 3300009093 Ga0105240_10000998 Ga0105240_1000099810 1097
107 3300009174 Ga0105241_10003048 Ga0105241_100030485 1097
108 3300009545 Ga0105237_10022394 Ga0105237_100223944 1097
109 3300009551 Ga0105238_10000790 Ga0105238_1000079022 1097
110 3300013307 Ga0157372_10041334 Ga0157372_100413341 1097
111 3300025913 Ga0207695_10001344 Ga0207695_1000134410 1097
112 3300025914 Ga0207671_10002972 Ga0207671_100029722 1097
113 3300025924 Ga0207694_10005846 Ga0207694_100058464 1097
114 3300032004 Ga0307414_10002858 Ga0307414_100028583 1097
115 3300044658 Ga0466972_0005920 Ga0466972_0005920_1824_5255 1097
116 3300048924 Ga0496121_0000007 Ga0496121_0000007_704768_708181 1097
117 iso_pu_bacteria 2896109856 2896110166 1097
118 iso_pu_bacteria 2929154850 2929159112 1098
119 3300053125 Ga0500618_000009 Ga0500618_000009_198326_201763 1099
120 3300044656 Ga0466969_0001424 Ga0466969_0001424_6303_9728 1100
121 3300044684 Ga0466966_0007949 Ga0466966_0007949_1007_4432 1100
122 3300045049 Ga0466959_0000029 Ga0466959_0000029_66766_70191 1100
123 iso_pu_bacteria 2902048731 2902052247 1100
124 3300053156 Ga0500622_0003686 Ga0500622_0003686_6302_9760 1101
125 3300025914 Ga0207671_10001966 Ga0207671_1000196612 1102
126 3300037312 Ga0395899_0000001 Ga0395899_0000001_57018_60383 1102
127 iso_pu_bacteria 2738541302 2738855997 1102
128 iso_pu_bacteria 2739367651 2739591018 1102
129 iso_pu_bacteria 2818991437 2819549938 1102
130 iso_pu_bacteria 2904445276 2904445952 1102
131 iso_pu_bacteria 2945997725 2946000293 1102
132 3300049823 Ga0501044_0001399 Ga0501044_0001399_10868_14281 1103
133 iso_pu_bacteria 2738541283 2738759631 1103
134 3300003322 rootL2_10121512 rootL2_101215123 1104
135 3300044658 Ga0466972_0000304 Ga0466972_0000304_85_3501 1104
136 3300046512 Ga0495610_0000047 Ga0495610_0000047_114842_118201 1104
137 3300005548 Ga0070665_100000041 Ga0070665_100000041103 1105
138 3300013306 Ga0163162_10001715 Ga0163162_100017157 1105
139 3300028379 Ga0268266_10000014 Ga0268266_1000001492 1105
140 3300028381 Ga0268264_10000327 Ga0268264_1000032746 1105
141 3300047443 Ga0495687_000144 Ga0495687_000144_74887_78318 1105
142 3300013296 Ga0157374_10000366 Ga0157374_100003669 1107
143 iso_pu_bacteria 2818991460 2819682139 1111
144 iso_pu_bacteria 2884791551 2884793989 1111
145 3300003320 rootH2_10012319 rootH2_1001231930 1114
146 3300005457 Ga0070662_100000845 Ga0070662_1000008453 1114
147 3300009093 Ga0105240_10001864 Ga0105240_1000186413 1114
148 3300009545 Ga0105237_10001212 Ga0105237_1000121213 1114
149 3300010375 Ga0105239_10004558 Ga0105239_100045584 1114
150 3300025904 Ga0207647_10000027 Ga0207647_1000002723 1114
151 3300025913 Ga0207695_10000055 Ga0207695_10000055127 1114
152 3300025933 Ga0207706_10000010 Ga0207706_1000001085 1114
153 iso_pu_bacteria 2738543023 2739304194 1114
154 3300002773 JGI25152J39213_1001677 JGI25152J39213_10016772 1116
155 3300002774 JGI25150J39212_1000027 JGI25150J39212_100002740 1116
156 3300003187 JGI25151J46595_10000120 JGI25151J46595_1000012044 1116
157 3300003215 JGI25153J46596_10000090 JGI25153J46596_1000009044 1116
158 3300025245 Ga0207425_1000004 Ga0207425_1000004190 1116
159 3300025258 Ga0209129_1000048 Ga0209129_1000048190 1116
160 3300025294 Ga0209025_1000009 Ga0209025_1000009190 1116
161 3300025297 Ga0209758_1000010 Ga0209758_1000010191 1116
162 iso_pu_bacteria 2739367656 2739616412 1116
163 iso_pu_bacteria 2954016120 2954017179 1116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07715

Plug

TonB-dependent Receptor Plug Domain

297

408

0.93

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

209

290

0.88

PF13715

CarbopepD_reg_2

CarboxypepD_reg-like domain

210

290

0.83

PF00593

TonB_dep_Rec_b-barrel

TonB dependent receptor-like, beta-barrel

595

1067

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sml-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8446 203 1116
8aa4-assembly1.cif.gz_B susc components of the dextran utilisation system (utilisome) 0.8429 203 1116
6sml-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8429 203 1116
8aa4-assembly1.cif.gz_B susc components of the dextran utilisation system (utilisome) 0.842 203 1116
6slj-assembly1.cif.gz_A structure of the ragab peptide transporter 0.8351 215 1116
ID Description Score Start End Superfamily
af_Q9JHW1_1212_1304_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8695 124 195 2.60.40.1120
af_O75976_383_462_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8301 124 195 2.60.40.1120
af_E7FFQ7_314_405_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8223 124 195 2.60.40.1120
af_E7FFQ7_1118_1203_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7847 125 200 2.60.40.1120
af_B7Z0Z5_381_464_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7666 124 195 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A353VTX8-F1-model_v4 SusC/RagA family TonB-linked outer membrane protein 0.9401 944 1116
AF-A0A3E5DY01-F1-model_v4 deleted 0.9341 229 1116
AF-A0A353VTX8-F1-model_v4 SusC/RagA family TonB-linked outer membrane protein 0.9299 944 1116
AF-A0A3E5DY01-F1-model_v4 deleted 0.9269 229 1116
AF-A0A1F3LM07-F1-model_v4 TonB-dependent receptor plug domain-containing protein 0.9149 179 1116 GO:0009279

Feature Viewer

pLDDT pTM Quality
80.03 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map