F242619

General Info

Members Datasets Scaffolds Average Seq Length
163 122 326 158

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_94025_c1|nmdc:mga0yw44_94025_c1_62_745
Length 175
Sequence MATHRFTVNGRPVSVEAEPEVRLLWVLRDLLGITGPKYGCGLSVCQACTSHINGVAFNPCSVPVGELRPDDAITTIEGLAASVGADLHPVQQAWLDHDVAQCGFCQPGQIMAVSALITRAVAEGRTLTSADFDALENVCRCGTYPRIRAAALTAYETITTAAPAPVRAAARAADG

Samples

Sample ID Description Type Environment
1 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
54 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
55 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
56 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
57 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
58 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
59 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
60 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
66 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
67 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
68 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
71 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
72 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
73 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
84 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
85 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
95 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
96 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
97 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
98 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
99 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
100 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
106 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
107 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
108 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
109 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
110 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
111 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
112 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
113 2643221561 Nocardioides sp. Root151 Isolate Unclassified
114 2643221696 Nocardioides sp. Root140 Isolate Unclassified
115 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
116 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
117 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
118 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
119 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
120 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
121 8002775197 Frankia nepalensis CN7 Isolate Nodule
122 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.57
Metatranscriptomes 4.29
Isolates 6.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.36
Nodule 1.84
Rhizoplane 3.68
Rhizosphere 79.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0yw44_94025_c1 3300050492 Bacteria 1899
2 Ga0058862_12670430 3300004803 Bacteria 6292
3 Ga0070683_100016628 3300005329 Bacteria 6492
4 Ga0070683_101137637 3300005329 Bacteria 750
5 Ga0070680_100000061 3300005336 Bacteria 56357
6 Ga0070680_100003320 3300005336 Bacteria 12009
7 Ga0070660_100727062 3300005339 Bacteria 833
8 Ga0070660_101637019 3300005339 Bacteria 548
9 Ga0070714_100182489 3300005435 Bacteria 1910
10 Ga0070714_100700902 3300005435 Bacteria 977
11 Ga0070700_100092451 3300005441 Bacteria 1977
12 Ga0070681_10000044 3300005458 Bacteria 85697
13 Ga0070681_10000471 3300005458 Bacteria 32815
14 Ga0070685_10957941 3300005466 Bacteria 640
15 Ga0070679_100000022 3300005530 Bacteria 123735
16 Ga0070679_100000720 3300005530 Bacteria 28535
17 Ga0070684_100718135 3300005535 Bacteria 932
18 Ga0068853_100345641 3300005539 Bacteria 1383
19 Ga0068855_100001513 3300005563 Bacteria 29118
20 Ga0068855_100025512 3300005563 Bacteria 7071
21 Ga0068856_100280961 3300005614 Bacteria 1681
22 Ga0068852_100136992 3300005616 Bacteria 2261
23 Ga0081455_10498345 3300005937 Bacteria 819
24 Ga0075365_10039901 3300006038 Bacteria 3059
25 Ga0075365_10107555 3300006038 Bacteria 1915
26 Ga0075367_10498082 3300006178 Bacteria 773
27 Ga0075370_10176953 3300006353 Bacteria 1255
28 Ga0105240_10168021 3300009093 Bacteria 2600
29 Ga0111539_11973373 3300009094 Bacteria 677
30 Ga0105241_10909344 3300009174 Bacteria 818
31 Ga0105237_10088690 3300009545 Bacteria 3082
32 Ga0105237_10120625 3300009545 Bacteria 2616
33 Ga0105238_12339049 3300009551 Bacteria 570
34 Ga0105239_10031526 3300010375 Bacteria 5828
35 Ga0105239_10340447 3300010375 Bacteria 1692
36 Ga0157370_10880781 3300013104 Bacteria 813
37 Ga0157369_10184674 3300013105 Bacteria 2193
38 Ga0157374_10925258 3300013296 Bacteria 890
39 Ga0157372_10520124 3300013307 Bacteria 1387
40 Ga0157372_11250915 3300013307 Bacteria 857
41 Ga0206356_10428132 3300020070 Bacteria 1822
42 Ga0206354_10090590 3300020081 Bacteria 2501
43 Ga0206353_10691472 3300020082 Bacteria 13074
44 Ga0154015_1476184 3300020610 Bacteria 2132
45 Ga0213875_10000252 3300021388 Bacteria 53969
46 Ga0224712_10037411 3300022467 Bacteria 1806
47 Ga0224712_10316010 3300022467 Bacteria 733
48 Ga0209758_1003868 3300025297 Bacteria 13115
49 Ga0207647_10057249 3300025904 Bacteria 2390
50 Ga0207705_10002542 3300025909 Bacteria 14047
51 Ga0207654_10095644 3300025911 Bacteria 1820
52 Ga0207654_10648931 3300025911 Bacteria 756
53 Ga0207654_11008064 3300025911 Bacteria 606
54 Ga0207707_10000041 3300025912 Bacteria 130140
55 Ga0207707_10000277 3300025912 Bacteria 55264
56 Ga0207695_10123532 3300025913 Bacteria 2554
57 Ga0207671_10088558 3300025914 Bacteria 2329
58 Ga0207660_10000115 3300025917 Bacteria 46447
59 Ga0207660_10000628 3300025917 Bacteria 23750
60 Ga0207660_10224416 3300025917 Bacteria 1475
61 Ga0207657_10661130 3300025919 Bacteria 813
62 Ga0207652_10000333 3300025921 Bacteria 48970
63 Ga0207652_10000533 3300025921 Bacteria 38625
64 Ga0207652_11130922 3300025921 Bacteria 684
65 Ga0207664_10236029 3300025929 Bacteria 1591
66 Ga0207664_10475416 3300025929 Bacteria 1117
67 Ga0207661_10095981 3300025944 Bacteria 2480
68 Ga0207667_10026476 3300025949 Bacteria 6336
69 Ga0207667_10056167 3300025949 Bacteria 4136
70 Ga0207708_10131581 3300026075 Bacteria 1956
71 Ga0207702_10216430 3300026078 Bacteria 1783
72 Ga0207702_11191788 3300026078 Bacteria 756
73 Ga0207702_11379381 3300026078 Bacteria 699
74 Ga0207698_10111622 3300026142 Bacteria 2293
75 Ga0268266_10011816 3300028379 Bacteria 7569
76 Ga0307511_10001301 3300030521 Bacteria 26468
77 Ga0307512_10016942 3300030522 Bacteria 6710
78 Ga0307513_10076624 3300031456 Bacteria 3467
79 Ga0307406_10736406 3300031901 Bacteria 826
80 Ga0307507_10039205 3300033179 Bacteria 4786
81 Ga0373953_0017535 3300035117 Bacteria 2634
82 Ga0373935_1030151 3300035692 Bacteria 612
83 Ga0373933_0093569 3300035724 Bacteria 1858
84 Ga0373937_0181653 3300036401 Bacteria 1975
85 Ga0395900_0020492 3300037418 Bacteria 6750
86 Ga0395898_0826146 3300037466 Bacteria 866
87 Ga0436364_0025107 3300037853 Bacteria 84205
88 Ga0436364_0920542 3300037853 Bacteria 617
89 Ga0451807_1492318 3300041486 Bacteria 681
90 Ga0466965_0641656 3300044683 Bacteria 606
91 Ga0466966_0126253 3300044684 Bacteria 1569
92 Ga0466961_0010289 3300044693 Bacteria 5962
93 Ga0466961_0713426 3300044693 Bacteria 600
94 Ga0466963_0002418 3300044694 Bacteria 10447
95 Ga0466963_0879687 3300044694 Bacteria 631
96 Ga0466964_0020011 3300044706 Bacteria 2576
97 Ga0466964_0158547 3300044706 Bacteria 1056
98 Ga0466964_0322194 3300044706 Bacteria 786
99 Ga0466971_0044635 3300044719 Bacteria 1990
100 Ga0466971_0191033 3300044719 Bacteria 965
101 Ga0466968_0105538 3300044735 Bacteria 1262
102 Ga0466968_0492838 3300044735 Bacteria 610
103 Ga0466970_0031722 3300044765 Bacteria 2791
104 Ga0466970_0052636 3300044765 Bacteria 2173
105 Ga0466970_0120991 3300044765 Bacteria 1434
106 Ga0466957_0937508 3300044842 Bacteria 620
107 Ga0466959_0134419 3300045049 Bacteria 1751
108 Ga0466958_0001334 3300045836 Bacteria 11653
109 Ga0466958_0289426 3300045836 Bacteria 1051
110 Ga0466967_0242770 3300045976 Bacteria 1719
111 Ga0466967_0342944 3300045976 Bacteria 1445
112 Ga0466967_0727442 3300045976 Bacteria 984
113 Ga0466967_1775615 3300045976 Bacteria 614
114 Ga0495641_0106865 3300046461 Bacteria 1249
115 Ga0495651_0093687 3300046462 Bacteria 2248
116 Ga0495653_0461916 3300046463 Bacteria 797
117 Ga0495639_0400119 3300046475 Bacteria 694
118 Ga0495608_0037122 3300046511 Bacteria 3277
119 Ga0495618_0373701 3300046514 Bacteria 875
120 Ga0495665_0090813 3300046531 Bacteria 1605
121 Ga0495645_0283506 3300046543 Bacteria 1088
122 Ga0495667_0002666 3300046559 Bacteria 11926
123 Ga0495634_0115208 3300046642 Bacteria 1725
124 Ga0495635_0034680 3300046663 Bacteria 3500
125 Ga0495657_0029062 3300046675 Bacteria 3880
126 Ga0495599_0058773 3300046678 Bacteria 2405
127 Ga0495613_0062897 3300046689 Bacteria 2716
128 Ga0495613_0888071 3300046689 Bacteria 577
129 Ga0495600_0011094 3300046809 Bacteria 5608
130 Ga0495604_0059788 3300047317 Bacteria 2920
131 Ga0495674_0075315 3300047319 Bacteria 2904
132 Ga0495676_0539694 3300047321 Bacteria 763
133 Ga0495680_0007611 3300047322 Bacteria 9899
134 Ga0495675_0070376 3300047444 Bacteria 2209
135 Ga0495684_0069847 3300047471 Bacteria 2670
136 Ga0495602_0006940 3300048088 Bacteria 11894
137 Ga0495614_0098281 3300048089 Bacteria 1278
138 Ga0496102_0001992 3300048905 Bacteria 17640
139 Ga0496106_0339207 3300048909 Bacteria 1207
140 Ga0496109_0833122 3300048912 Bacteria 860
141 Ga0496113_0483976 3300048916 Bacteria 994
142 Ga0496113_0762859 3300048916 Bacteria 770
143 nmdc:mga0yw44_115004_c1 3300050492 Bacteria 1727
144 nmdc:mga0yw44_940436_c1 3300050492 Bacteria 586
145 nmdc:mga06z11_468384_c1 3300050494 Bacteria 762
146 Ga0495601_0158878 3300053077 Bacteria 1477
147 Ga0495601_0227526 3300053077 Bacteria 1218
148 Ga0495595_0352860 3300053084 Bacteria 742
149 Ga0495619_0349084 3300053085 Bacteria 1023
150 Ga0500644_0154177 3300053088 Bacteria 923
151 Ga0500658_0360884 3300053134 Bacteria 667
152 Ga0500577_0039093 3300053142 Bacteria 1717
153 Ga0466962_0022823 3300061719 Bacteria 3007
154 2643827038 2643221561 Bacteria 4984412
155 2644534390 2643221696 Bacteria 5431823
156 2676205593 2675902999 Bacteria 9438463
157 2774850168 2773857921 Bacteria 9435764
158 2812351419 2811994878 Bacteria 5992952
159 2819743674 2818991472 Bacteria 10089953
160 2990093944 2990088156 Bacteria 6657676
161 2995470421 2995463766 Bacteria 8577691
162 8002781200 8002775197 Bacteria 10728764
163 8047715681 8047710418 Bacteria 11023148
164 nmdc:mga0yw44_94025_c1
165 Ga0058862_12670430
166 Ga0070683_100016628
167 Ga0070683_101137637
168 Ga0070680_100000061
169 Ga0070680_100003320
170 Ga0070660_100727062
171 Ga0070660_101637019
172 Ga0070714_100182489
173 Ga0070714_100700902
174 Ga0070700_100092451
175 Ga0070681_10000044
176 Ga0070681_10000471
177 Ga0070685_10957941
178 Ga0070679_100000022
179 Ga0070679_100000720
180 Ga0070684_100718135
181 Ga0068853_100345641
182 Ga0068855_100001513
183 Ga0068855_100025512
184 Ga0068856_100280961
185 Ga0068852_100136992
186 Ga0081455_10498345
187 Ga0075365_10039901
188 Ga0075365_10107555
189 Ga0075367_10498082
190 Ga0075370_10176953
191 Ga0105240_10168021
192 Ga0111539_11973373
193 Ga0105241_10909344
194 Ga0105237_10088690
195 Ga0105237_10120625
196 Ga0105238_12339049
197 Ga0105239_10031526
198 Ga0105239_10340447
199 Ga0157370_10880781
200 Ga0157369_10184674
201 Ga0157374_10925258
202 Ga0157372_10520124
203 Ga0157372_11250915
204 Ga0206356_10428132
205 Ga0206354_10090590
206 Ga0206353_10691472
207 Ga0154015_1476184
208 Ga0213875_10000252
209 Ga0224712_10037411
210 Ga0224712_10316010
211 Ga0209758_1003868
212 Ga0207647_10057249
213 Ga0207705_10002542
214 Ga0207654_10095644
215 Ga0207654_10648931
216 Ga0207654_11008064
217 Ga0207707_10000041
218 Ga0207707_10000277
219 Ga0207695_10123532
220 Ga0207671_10088558
221 Ga0207660_10000115
222 Ga0207660_10000628
223 Ga0207660_10224416
224 Ga0207657_10661130
225 Ga0207652_10000333
226 Ga0207652_10000533
227 Ga0207652_11130922
228 Ga0207664_10236029
229 Ga0207664_10475416
230 Ga0207661_10095981
231 Ga0207667_10026476
232 Ga0207667_10056167
233 Ga0207708_10131581
234 Ga0207702_10216430
235 Ga0207702_11191788
236 Ga0207702_11379381
237 Ga0207698_10111622
238 Ga0268266_10011816
239 Ga0307511_10001301
240 Ga0307512_10016942
241 Ga0307513_10076624
242 Ga0307406_10736406
243 Ga0307507_10039205
244 Ga0373953_0017535
245 Ga0373935_1030151
246 Ga0373933_0093569
247 Ga0373937_0181653
248 Ga0395900_0020492
249 Ga0395898_0826146
250 Ga0436364_0025107
251 Ga0436364_0920542
252 Ga0451807_1492318
253 Ga0466965_0641656
254 Ga0466966_0126253
255 Ga0466961_0010289
256 Ga0466961_0713426
257 Ga0466963_0002418
258 Ga0466963_0879687
259 Ga0466964_0020011
260 Ga0466964_0158547
261 Ga0466964_0322194
262 Ga0466971_0044635
263 Ga0466971_0191033
264 Ga0466968_0105538
265 Ga0466968_0492838
266 Ga0466970_0031722
267 Ga0466970_0052636
268 Ga0466970_0120991
269 Ga0466957_0937508
270 Ga0466959_0134419
271 Ga0466958_0001334
272 Ga0466958_0289426
273 Ga0466967_0242770
274 Ga0466967_0342944
275 Ga0466967_0727442
276 Ga0466967_1775615
277 Ga0495641_0106865
278 Ga0495651_0093687
279 Ga0495653_0461916
280 Ga0495639_0400119
281 Ga0495608_0037122
282 Ga0495618_0373701
283 Ga0495665_0090813
284 Ga0495645_0283506
285 Ga0495667_0002666
286 Ga0495634_0115208
287 Ga0495635_0034680
288 Ga0495657_0029062
289 Ga0495599_0058773
290 Ga0495613_0062897
291 Ga0495613_0888071
292 Ga0495600_0011094
293 Ga0495604_0059788
294 Ga0495674_0075315
295 Ga0495676_0539694
296 Ga0495680_0007611
297 Ga0495675_0070376
298 Ga0495684_0069847
299 Ga0495602_0006940
300 Ga0495614_0098281
301 Ga0496102_0001992
302 Ga0496106_0339207
303 Ga0496109_0833122
304 Ga0496113_0483976
305 Ga0496113_0762859
306 nmdc:mga0yw44_115004_c1
307 nmdc:mga0yw44_940436_c1
308 nmdc:mga06z11_468384_c1
309 Ga0495601_0158878
310 Ga0495601_0227526
311 Ga0495595_0352860
312 Ga0495619_0349084
313 Ga0500644_0154177
314 Ga0500658_0360884
315 Ga0500577_0039093
316 Ga0466962_0022823
317 2643827038
318 2644534390
319 2676205593
320 2774850168
321 2812351419
322 2819743674
323 2990093944
324 2995470421
325 8002781200
326 8047715681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

6

73

0.88

PF01799

Fer2_2

[2Fe-2S] binding domain

75

152

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4crh-assembly1.cif.gz_A crystal structure of the btb-t1 domain of human shkbp1 0.7118 2 15
8b9z-assembly1.cif.gz_G drosophila melanogaster complex i in the active state (dm1) 0.6466 3 82
2i2r-assembly3.cif.gz_C crystal structure of the kchip1/kv4.3 t1 complex 0.6217 2 15
2i2r-assembly3.cif.gz_I crystal structure of the kchip1/kv4.3 t1 complex 0.6199 2 15
2i2r-assembly3.cif.gz_B crystal structure of the kchip1/kv4.3 t1 complex 0.6187 2 15
ID Description Score Start End Superfamily
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8879 2 77 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8859 2 78 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8814 1 78 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8804 2 76 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8712 1 78 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A257LNN9-F1-model_v4 (2Fe-2S)-binding protein 0.9104 1 75 GO:0051537
AF-A0A1Q7AH13-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9096 1 80 GO:0051537
AF-A0A800BKA9-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9066 1 79 GO:0051537
AF-A0A3N5M339-F1-model_v4 (2Fe-2S)-binding protein 0.9055 2 79 GO:0051537
AF-A0A350W5E3-F1-model_v4 Ferredoxin 0.9044 2 78 GO:0051537

Map