F242063

General Info

Members Datasets Scaffolds Average Seq Length
163 130 326 281

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0165591|Ga0373937_0165591_354_1226
Length 274
Sequence MAEAPNAAQTSVVIPAFNEAASIATVVHDLTSAAGWQEILVVDDGSTDETGERAAAAGARVIRHPYNKGNGAAVKTGIRHAAGVFILITDADGQHRPLDAARLVGHLGAYDLVVGARSGQTQASLVRRLGNATLNRVASYLTEQPIPDLTSGFRAARREYLLEFIHLLPNGFSTPTTTTLAFMRAGYSVRFEPIDAAQRAGVSKIRLGTDGFNFLLILLKVITIFSPLYAAWTIFTQSHVTNSSVLLILVSVVILLVGLVSEQISTLRIEGRRQ

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
64 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
65 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
66 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
67 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
68 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
69 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
70 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
71 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
76 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
77 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
78 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
79 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
80 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
81 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
86 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
87 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
93 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
96 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
118 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
126 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
127 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
128 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 2.45
Rhizosphere 96.93
Stem 0
Stem Tuber 0
Unclassified 7.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0165591 3300036401 Unclassified 2073
2 Ga0065707_10221252 3300005295 Bacteria 1224
3 Ga0070690_100148880 3300005330 Bacteria 1595
4 Ga0070670_100042068 3300005331 Bacteria 3927
5 Ga0070680_100096170 3300005336 Unclassified 2456
6 Ga0070689_100083253 3300005340 Bacteria 2514
7 Ga0070668_100395453 3300005347 Bacteria 1179
8 Ga0070669_100031621 3300005353 Bacteria 3823
9 Ga0070674_100003342 3300005356 Bacteria 8981
10 Ga0070674_100060461 3300005356 Bacteria 2641
11 Ga0070709_10001229 3300005434 Bacteria 14045
12 Ga0070713_100003818 3300005436 Bacteria 9970
13 Ga0070708_100093931 3300005445 Bacteria 2736
14 Ga0070681_10001687 3300005458 Bacteria 19755
15 Ga0070679_100066335 3300005530 Unclassified 3598
16 Ga0068852_100103546 3300005616 Bacteria 2574
17 Ga0068859_100448087 3300005617 Bacteria 1387
18 Ga0068864_100356045 3300005618 Bacteria 1382
19 Ga0068861_100480830 3300005719 Bacteria 1119
20 Ga0068858_100001189 3300005842 Bacteria 26942
21 Ga0068858_100118305 3300005842 Bacteria 2477
22 Ga0068862_100486414 3300005844 Bacteria 1169
23 Ga0081455_10057619 3300005937 Bacteria 3292
24 Ga0070716_100176114 3300006173 Bacteria 1400
25 Ga0097621_100001459 3300006237 Bacteria 16171
26 Ga0068871_100110183 3300006358 Bacteria 2315
27 Ga0068871_100149832 3300006358 Bacteria 1988
28 Ga0075428_100010662 3300006844 Bacteria 10214
29 Ga0075430_100456613 3300006846 Bacteria 1054
30 Ga0075433_10244738 3300006852 Bacteria 1592
31 Ga0075434_100008333 3300006871 Bacteria 9631
32 Ga0075434_100525972 3300006871 Bacteria 1203
33 Ga0068865_100197794 3300006881 Bacteria 1559
34 Ga0097620_100448079 3300006931 Bacteria 1387
35 Ga0075435_100012963 3300007076 Bacteria 6184
36 Ga0075435_100068823 3300007076 Bacteria 2884
37 Ga0111539_10005052 3300009094 Bacteria 17138
38 Ga0111539_10199702 3300009094 Bacteria 2332
39 Ga0114129_10002512 3300009147 Bacteria 25458
40 Ga0114129_10002976 3300009147 Bacteria 23733
41 Ga0114129_10400563 3300009147 Bacteria 1809
42 Ga0105248_10028728 3300009177 Bacteria 6199
43 Ga0105249_10064345 3300009553 Bacteria 3371
44 Ga0157378_10002383 3300013297 Bacteria 16687
45 Ga0157379_10016646 3300014968 Bacteria 6465
46 Ga0157376_10064261 3300014969 Bacteria 3095
47 Ga0207682_10041465 3300025893 Bacteria 1879
48 Ga0207688_10188085 3300025901 Bacteria 1234
49 Ga0207660_10060145 3300025917 Unclassified 2730
50 Ga0207649_10077524 3300025920 Unclassified 2142
51 Ga0207652_10293012 3300025921 Unclassified 1468
52 Ga0207646_10231601 3300025922 Bacteria 1669
53 Ga0207681_10138527 3300025923 Bacteria 1809
54 Ga0207650_10035203 3300025925 Bacteria 3634
55 Ga0207670_10177898 3300025936 Unclassified 1600
56 Ga0207669_10072802 3300025937 Bacteria 2165
57 Ga0207669_10089288 3300025937 Bacteria 2001
58 Ga0207669_10096050 3300025937 Bacteria 1944
59 Ga0207669_10100509 3300025937 Bacteria 1911
60 Ga0207665_10032679 3300025939 Bacteria 3446
61 Ga0207711_10026725 3300025941 Bacteria 4845
62 Ga0207712_10160424 3300025961 Bacteria 1747
63 Ga0207668_10298352 3300025972 Bacteria 1329
64 Ga0207640_10033706 3300025981 Bacteria 3189
65 Ga0207658_10273827 3300025986 Bacteria 1444
66 Ga0207703_10010663 3300026035 Bacteria 7178
67 Ga0207703_10091169 3300026035 Bacteria 2563
68 Ga0207676_10465009 3300026095 Bacteria 1195
69 Ga0207674_10073136 3300026116 Unclassified 3442
70 Ga0207675_100363764 3300026118 Unclassified 1420
71 Ga0207675_100393065 3300026118 Bacteria 1365
72 Ga0207683_10057984 3300026121 Bacteria 3399
73 Ga0207428_10004284 3300027907 Bacteria 13648
74 Ga0268266_10453222 3300028379 Bacteria 1220
75 Ga0268266_10536332 3300028379 Bacteria 1120
76 Ga0268264_10413649 3300028381 Bacteria 1299
77 Ga0373923_0027240 3300035111 Bacteria 2279
78 Ga0373936_0016603 3300035113 Bacteria 2833
79 Ga0373941_0014209 3300035115 Bacteria 2121
80 Ga0373945_0049358 3300035116 Bacteria 1544
81 Ga0373957_0140660 3300035120 Bacteria 987
82 Ga0373943_0001164 3300035170 Bacteria 11748
83 Ga0373946_0006044 3300035171 Bacteria 4391
84 Ga0373955_0005044 3300035172 Bacteria 5904
85 Ga0373924_0005479 3300035410 Bacteria 4497
86 Ga0373931_0107013 3300035691 Bacteria 1581
87 Ga0373947_0003351 3300035725 Bacteria 9485
88 Ga0373937_0413125 3300036401 Bacteria 1280
89 Ga0395901_0651287 3300038443 Bacteria 1057
90 Ga0439457_038547 3300042014 Bacteria 1063
91 Ga0450896_004440 3300042133 Bacteria 1901
92 Ga0439435_0002017 3300042436 Bacteria 3921
93 Ga0439460_0003307 3300042461 Bacteria 3905
94 Ga0495592_0039201 3300046454 Bacteria 3560
95 Ga0495594_0033662 3300046499 Bacteria 2787
96 Ga0495618_0241477 3300046514 Bacteria 1135
97 Ga0495628_0167702 3300046516 Bacteria 1666
98 Ga0495665_0151654 3300046531 Bacteria 1210
99 Ga0495640_0224733 3300046533 Bacteria 1183
100 Ga0495586_0138495 3300046535 Bacteria 1365
101 Ga0495598_0008052 3300046537 Bacteria 2443
102 Ga0495621_0007457 3300046539 Bacteria 3240
103 Ga0495645_0064996 3300046543 Bacteria 2639
104 Ga0495667_0057985 3300046559 Bacteria 2544
105 Ga0495634_0136066 3300046642 Bacteria 1563
106 Ga0495635_0024299 3300046663 Bacteria 4225
107 Ga0495588_0002942 3300046674 Bacteria 7359
108 Ga0495599_0029104 3300046678 Bacteria 3462
109 Ga0495658_0004399 3300046683 Bacteria 6939
110 Ga0495600_0297328 3300046809 Unclassified 1019
111 Ga0495604_0022772 3300047317 Bacteria 5001
112 Ga0496101_0102465 3300048904 Bacteria 2144
113 Ga0496108_0213618 3300048911 Bacteria 1675
114 Ga0496110_0027542 3300048913 Bacteria 4873
115 Ga0496112_0292792 3300048915 Bacteria 1574
116 Ga0501032_0040454 3300049569 Bacteria 3169
117 Ga0501033_0048510 3300049570 Bacteria 3154
118 Ga0501034_0217904 3300049571 Bacteria 1862
119 Ga0501036_0030611 3300049572 Bacteria 4545
120 Ga0501038_0038837 3300049574 Bacteria 4167
121 Ga0501038_0119090 3300049574 Bacteria 2179
122 Ga0501039_0022659 3300049575 Bacteria 4820
123 Ga0501039_0131726 3300049575 Bacteria 1962
124 Ga0501040_0000223 3300049576 Bacteria 33236
125 Ga0501042_0016622 3300049578 Bacteria 5054
126 Ga0501042_0251478 3300049578 Bacteria 1275
127 Ga0501046_0002558 3300049580 Bacteria 17022
128 Ga0501047_0002524 3300049581 Bacteria 17437
129 Ga0501047_0292302 3300049581 Bacteria 1473
130 Ga0501071_0011572 3300049587 Bacteria 5953
131 Ga0501071_0164611 3300049587 Bacteria 1659
132 Ga0501072_0048299 3300049588 Unclassified 3351
133 Ga0501072_0134029 3300049588 Bacteria 1975
134 Ga0501073_0001727 3300049589 Bacteria 16237
135 Ga0501073_0053097 3300049589 Bacteria 2837
136 Ga0501073_0073090 3300049589 Bacteria 2388
137 Ga0501074_0049216 3300049590 Bacteria 3043
138 Ga0501075_0026333 3300049591 Bacteria 4280
139 Ga0501075_0028887 3300049591 Bacteria 4097
140 Ga0501076_0000179 3300049592 Bacteria 37508
141 Ga0501076_0028319 3300049592 Bacteria 4349
142 Ga0501076_0356131 3300049592 Bacteria 1202
143 Ga0501077_0010322 3300049593 Bacteria 5811
144 Ga0501077_0082658 3300049593 Bacteria 2035
145 Ga0501079_0030833 3300049741 Unclassified 4120
146 Ga0501079_0193150 3300049741 Bacteria 1589
147 Ga0501044_0004893 3300049823 Bacteria 14967
148 Ga0501045_0052826 3300049824 Bacteria 2968
149 nmdc:mga05p37_38415_c1 3300050507 Bacteria 5872
150 nmdc:mga06r32_147004_c1 3300050510 Bacteria 2334
151 nmdc:mga08y16_3210_c1 3300050511 Bacteria 16913
152 nmdc:mga0rr50_27987_c1 3300050513 Bacteria 3956
153 nmdc:mga0a205_1881_c1 3300050515 Bacteria 18198
154 nmdc:mga0a205_324136_c1 3300050515 Bacteria 1411
155 Ga0495601_0065566 3300053077 Bacteria 2311
156 Ga0500658_0145687 3300053134 Bacteria 1065
157 Ga0501084_0000669 3300054114 Bacteria 26157
158 Ga0501084_0124376 3300054114 Bacteria 2170
159 Ga0501084_0501105 3300054114 Bacteria 1026
160 Ga0501082_0044960 3300060353 Bacteria 3808
161 Ga0501082_0055958 3300060353 Bacteria 3398
162 Ga0501082_0079006 3300060353 Bacteria 2838
163 Ga0530510_0000198 3300061734 Bacteria 37256
164 Ga0373937_0165591
165 Ga0065707_10221252
166 Ga0070690_100148880
167 Ga0070670_100042068
168 Ga0070680_100096170
169 Ga0070689_100083253
170 Ga0070668_100395453
171 Ga0070669_100031621
172 Ga0070674_100003342
173 Ga0070674_100060461
174 Ga0070709_10001229
175 Ga0070713_100003818
176 Ga0070708_100093931
177 Ga0070681_10001687
178 Ga0070679_100066335
179 Ga0068852_100103546
180 Ga0068859_100448087
181 Ga0068864_100356045
182 Ga0068861_100480830
183 Ga0068858_100001189
184 Ga0068858_100118305
185 Ga0068862_100486414
186 Ga0081455_10057619
187 Ga0070716_100176114
188 Ga0097621_100001459
189 Ga0068871_100110183
190 Ga0068871_100149832
191 Ga0075428_100010662
192 Ga0075430_100456613
193 Ga0075433_10244738
194 Ga0075434_100008333
195 Ga0075434_100525972
196 Ga0068865_100197794
197 Ga0097620_100448079
198 Ga0075435_100012963
199 Ga0075435_100068823
200 Ga0111539_10005052
201 Ga0111539_10199702
202 Ga0114129_10002512
203 Ga0114129_10002976
204 Ga0114129_10400563
205 Ga0105248_10028728
206 Ga0105249_10064345
207 Ga0157378_10002383
208 Ga0157379_10016646
209 Ga0157376_10064261
210 Ga0207682_10041465
211 Ga0207688_10188085
212 Ga0207660_10060145
213 Ga0207649_10077524
214 Ga0207652_10293012
215 Ga0207646_10231601
216 Ga0207681_10138527
217 Ga0207650_10035203
218 Ga0207670_10177898
219 Ga0207669_10072802
220 Ga0207669_10089288
221 Ga0207669_10096050
222 Ga0207669_10100509
223 Ga0207665_10032679
224 Ga0207711_10026725
225 Ga0207712_10160424
226 Ga0207668_10298352
227 Ga0207640_10033706
228 Ga0207658_10273827
229 Ga0207703_10010663
230 Ga0207703_10091169
231 Ga0207676_10465009
232 Ga0207674_10073136
233 Ga0207675_100363764
234 Ga0207675_100393065
235 Ga0207683_10057984
236 Ga0207428_10004284
237 Ga0268266_10453222
238 Ga0268266_10536332
239 Ga0268264_10413649
240 Ga0373923_0027240
241 Ga0373936_0016603
242 Ga0373941_0014209
243 Ga0373945_0049358
244 Ga0373957_0140660
245 Ga0373943_0001164
246 Ga0373946_0006044
247 Ga0373955_0005044
248 Ga0373924_0005479
249 Ga0373931_0107013
250 Ga0373947_0003351
251 Ga0373937_0413125
252 Ga0395901_0651287
253 Ga0439457_038547
254 Ga0450896_004440
255 Ga0439435_0002017
256 Ga0439460_0003307
257 Ga0495592_0039201
258 Ga0495594_0033662
259 Ga0495618_0241477
260 Ga0495628_0167702
261 Ga0495665_0151654
262 Ga0495640_0224733
263 Ga0495586_0138495
264 Ga0495598_0008052
265 Ga0495621_0007457
266 Ga0495645_0064996
267 Ga0495667_0057985
268 Ga0495634_0136066
269 Ga0495635_0024299
270 Ga0495588_0002942
271 Ga0495599_0029104
272 Ga0495658_0004399
273 Ga0495600_0297328
274 Ga0495604_0022772
275 Ga0496101_0102465
276 Ga0496108_0213618
277 Ga0496110_0027542
278 Ga0496112_0292792
279 Ga0501032_0040454
280 Ga0501033_0048510
281 Ga0501034_0217904
282 Ga0501036_0030611
283 Ga0501038_0038837
284 Ga0501038_0119090
285 Ga0501039_0022659
286 Ga0501039_0131726
287 Ga0501040_0000223
288 Ga0501042_0016622
289 Ga0501042_0251478
290 Ga0501046_0002558
291 Ga0501047_0002524
292 Ga0501047_0292302
293 Ga0501071_0011572
294 Ga0501071_0164611
295 Ga0501072_0048299
296 Ga0501072_0134029
297 Ga0501073_0001727
298 Ga0501073_0053097
299 Ga0501073_0073090
300 Ga0501074_0049216
301 Ga0501075_0026333
302 Ga0501075_0028887
303 Ga0501076_0000179
304 Ga0501076_0028319
305 Ga0501076_0356131
306 Ga0501077_0010322
307 Ga0501077_0082658
308 Ga0501079_0030833
309 Ga0501079_0193150
310 Ga0501044_0004893
311 Ga0501045_0052826
312 nmdc:mga05p37_38415_c1
313 nmdc:mga06r32_147004_c1
314 nmdc:mga08y16_3210_c1
315 nmdc:mga0rr50_27987_c1
316 nmdc:mga0a205_1881_c1
317 nmdc:mga0a205_324136_c1
318 Ga0495601_0065566
319 Ga0500658_0145687
320 Ga0501084_0000669
321 Ga0501084_0124376
322 Ga0501084_0501105
323 Ga0501082_0044960
324 Ga0501082_0055958
325 Ga0501082_0079006
326 Ga0530510_0000198

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

11

164

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4de7-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mg2+ and uridine-diphosphate (udp) 0.8247 11 225
4y6n-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate-glucose (udp-glc) and phosphoglyceric acid (pga) - gpgs mn2+ udp-glc pga-1 0.8187 11 225
7pd5-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with 4-aminobenzoic acid 0.8099 11 227
4dec-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and phosphoglyceric acid (pga) 0.8089 11 225
5jud-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with uridine-diphosphate (udp) - gpgs*udp 0.8042 11 225
ID Description Score Start End Superfamily
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.902 13 225 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8819 13 225 3.90.550.10
af_O60061_43_318_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8568 13 225 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8366 13 225 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8359 2 225 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7C3D639-F1-model_v4 Glycosyltransferase family 2 protein 0.9453 12 113 GO:0016757
AF-A0A1F8Q2Q7-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9318 14 226 GO:0016757
AF-A0A1W9PLF8-F1-model_v4 Glycosyl transferase 0.9303 13 291 GO:0016020
GO:0016757
AF-A0A1F9E6E7-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9289 13 101 GO:0016757
AF-A0A2E4JGN7-F1-model_v4 Glycosyl transferase 0.9246 9 292 GO:0016020
GO:0016757

Map