F241877

General Info

Members Datasets Scaffolds Average Seq Length
163 122 148 418

Family's Representative Sequence

Representative Sequence 3300028381|Ga0268264_10140016|Ga0268264_101400161
Length 486
Sequence MPQLGIGLQLFYGIGQFHRNGLRYPGLCMYNKEEKDQFFHVGKLVKSGMFQLRSYTHKVAYICLELPSMEKIVASIITIGDELLIGQVIDTNSAFIAQELNKTGVWVKRRVAVGDSKEEIIRALNEESRDTQIIIITGGLGPTADDITKPVLAEYFGGKLVVNEEVLKHLRYLFEHVFRRPLIERNLKQAEVPDVCTVLPNARGTAPGMWFEKAGKVFVSLPGVPHEMKGLITSEVLPRLQQQFQMPFISHRTLLTAGIGESYIADTIKDWEEKLPAHLKLAYLPNYGMVRLRITGWSTDKDQLENELNSEFANLKILVREWLVTDEDNTLAMTLNKLLRAKNKTMATAESCTGGYIAHLITAIPGASNIYKGSIISYDNEIKISALNVSPATLQQAGAVSEEVVKEMAAGALATLNTDYALAVSGIMGPDGGSPEKPVGTVWVAAGDRNKLVTQKFLFRFDRDRNIEMTATQALNLLRKFVVENA

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2818991444 Filimonas endophytica 3197 Isolate Unclassified
4 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
5 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
6 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
7 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
8 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
9 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
10 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
11 2914759650 Rhizosphaericola mali Isolate Rhizosphere
12 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
13 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
14 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
15 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
58 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
93 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
94 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
102 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
113 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
114 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
115 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
116 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
117 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
118 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
119 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
120 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
121 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
122 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.8
Metatranscriptomes 0
Isolates 9.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.86
Nodule 0
Rhizoplane 0
Rhizosphere 63.8
Stem 0
Stem Tuber 0
Unclassified 15.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000014 3300002738 Bacteria 265287
2 JGI25153J46596_10001718 3300003215 Bacteria 12979
3 JGI25153J46596_10010173 3300003215 Bacteria 4279
4 rootH1_10014739 3300003316 Bacteria 2708
5 rootH1_10168875 3300003316 Unclassified 2527
6 rootL2_10055158 3300003322 Bacteria 2107
7 rootH1_10160499 3300003323 Bacteria 2763
8 rootH1_10201000 3300003323 Bacteria 2767
9 rootH1_10250213 3300003323 Bacteria 2119
10 JGI25160J50197_1001100 3300003354 Bacteria 13814
11 Ga0055542_1009820 3300003762 Bacteria 1785
12 Ga0055528_1001076 3300003790 Bacteria 18002
13 Ga0055530_10000480 3300003791 Bacteria 34766
14 Ga0055531_10000093 3300003794 Bacteria 97901
15 Ga0065165_1000036 3300005262 Bacteria 212900
16 Ga0065165_1005970 3300005262 Bacteria 6581
17 Ga0065704_10079820 3300005289 Bacteria 4041
18 Ga0068869_100024446 3300005334 Bacteria 4185
19 Ga0068868_100038360 3300005338 Bacteria 3718
20 Ga0070675_100002335 3300005354 Bacteria 14099
21 Ga0070673_100008494 3300005364 Bacteria 6828
22 Ga0070673_100284951 3300005364 Bacteria 1450
23 Ga0070659_100053794 3300005366 Bacteria 3169
24 Ga0070713_100036035 3300005436 Bacteria 3989
25 Ga0070679_100001490 3300005530 Bacteria 20789
26 Ga0068853_100032286 3300005539 Bacteria 4434
27 Ga0068853_100055399 3300005539 Bacteria 3417
28 Ga0070672_100030841 3300005543 Bacteria 4032
29 Ga0070665_100268627 3300005548 Bacteria 1707
30 Ga0068855_100060433 3300005563 Bacteria 4432
31 Ga0068855_100108937 3300005563 Bacteria 3181
32 Ga0068855_100267308 3300005563 Bacteria 1903
33 Ga0070664_100019018 3300005564 Bacteria 5648
34 Ga0068854_100081691 3300005578 Bacteria 2388
35 Ga0068852_100013686 3300005616 Bacteria 6215
36 Ga0068852_100033787 3300005616 Bacteria 4251
37 Ga0068864_100032114 3300005618 Bacteria 4458
38 Ga0068860_100006943 3300005843 Bacteria 11349
39 Ga0068860_100064541 3300005843 Bacteria 3478
40 Ga0068860_100149998 3300005843 Unclassified 2245
41 Ga0068862_100234410 3300005844 Bacteria 1666
42 Ga0097621_100076222 3300006237 Bacteria 2781
43 Ga0097621_100080983 3300006237 Bacteria 2702
44 Ga0111539_10018486 3300009094 Bacteria 8633
45 Ga0111539_10321545 3300009094 Bacteria 1800
46 Ga0114129_10006710 3300009147 Bacteria 16344
47 Ga0105241_10009065 3300009174 Bacteria 7317
48 Ga0105237_10011720 3300009545 Bacteria 9271
49 Ga0105237_10045382 3300009545 Bacteria 4423
50 Ga0105239_10039187 3300010375 Bacteria 5191
51 Ga0105239_10078063 3300010375 Bacteria 3644
52 Ga0157373_10040132 3300013100 Bacteria 3350
53 Ga0157373_10072735 3300013100 Bacteria 2426
54 Ga0157371_10052771 3300013102 Bacteria 2887
55 Ga0157370_10020705 3300013104 Bacteria 6562
56 Ga0157369_10008242 3300013105 Bacteria 11946
57 Ga0157378_10020000 3300013297 Bacteria 5886
58 Ga0163162_10027218 3300013306 Bacteria 5653
59 Ga0157376_10073078 3300014969 Bacteria 2919
60 Ga0157376_10148050 3300014969 Bacteria 2114
61 Ga0182005_1000039 3300015265 Bacteria 155210
62 Ga0209436_102525 3300025208 Bacteria 5435
63 Ga0209258_100195 3300025242 Bacteria 124409
64 Ga0209646_1000002 3300025246 Bacteria 1425781
65 Ga0209026_1000178 3300025250 Bacteria 96368
66 Ga0209148_1000515 3300025254 Bacteria 38582
67 Ga0209673_1000261 3300025273 Bacteria 99491
68 Ga0209564_1031343 3300025295 Bacteria 1627
69 Ga0209758_1004617 3300025297 Bacteria 11305
70 Ga0209758_1038377 3300025297 Unclassified 1837
71 Ga0209050_1000160 3300025298 Bacteria 157000
72 Ga0207426_1000023 3300025302 Bacteria 545465
73 Ga0207426_1000360 3300025302 Bacteria 82007
74 Ga0207426_1001116 3300025302 Bacteria 24631
75 Ga0207426_1013538 3300025302 Bacteria 3019
76 Ga0209257_1000001 3300025304 Bacteria 2274655
77 Ga0209257_1003010 3300025304 Bacteria 15255
78 Ga0207680_10146473 3300025903 Bacteria 1570
79 Ga0207705_10029234 3300025909 Bacteria 3928
80 Ga0207705_10061868 3300025909 Bacteria 2704
81 Ga0207654_10093556 3300025911 Bacteria 1838
82 Ga0207695_10110289 3300025913 Bacteria 2732
83 Ga0207671_10000102 3300025914 Bacteria 130461
84 Ga0207671_10098352 3300025914 Bacteria 2213
85 Ga0207652_10000765 3300025921 Bacteria 30774
86 Ga0207659_10029063 3300025926 Bacteria 3763
87 Ga0207700_10194977 3300025928 Bacteria 1704
88 Ga0207690_10017605 3300025932 Bacteria 4367
89 Ga0207691_10059788 3300025940 Bacteria 3464
90 Ga0207689_10036167 3300025942 Bacteria 4100
91 Ga0207667_10045484 3300025949 Bacteria 4649
92 Ga0207667_10073006 3300025949 Bacteria 3566
93 Ga0207667_10220513 3300025949 Bacteria 1943
94 Ga0207651_10228558 3300025960 Bacteria 1509
95 Ga0207639_10047304 3300026041 Bacteria 3250
96 Ga0207702_10036570 3300026078 Bacteria 4108
97 Ga0207674_10048645 3300026116 Bacteria 4339
98 Ga0207698_10298590 3300026142 Bacteria 1498
99 Ga0268265_10112524 3300028380 Bacteria 2225
100 Ga0268265_10216509 3300028380 Bacteria 1673
101 Ga0268264_10051023 3300028381 Unclassified 3446
102 Ga0268264_10127315 3300028381 Unclassified 2253
103 Ga0268264_10140016 3300028381 Bacteria 2156
104 Ga0265327_10000030 3300031251 Bacteria 333531
105 Ga0265327_10042335 3300031251 Bacteria 2446
106 Ga0265327_10054940 3300031251 Bacteria 2059
107 Ga0373927_0056252 3300035695 Bacteria 2543
108 Ga0395901_0003274 3300038443 Bacteria 16310
109 Ga0436365_1457825 3300039437 Unclassified 1975
110 Ga0439431_0000897 3300041997 Bacteria 6434
111 Ga0439445_0005210 3300042004 Bacteria 2957
112 Ga0439449_0009170 3300042007 Bacteria 3750
113 Ga0451577_0027136 3300042876 Bacteria 5183
114 Ga0466972_0000038 3300044658 Bacteria 135937
115 Ga0466966_0001759 3300044684 Bacteria 14029
116 Ga0453684_0089263 3300044712 Unclassified 3813
117 Ga0453684_0219825 3300044712 Unclassified 2201
118 Ga0466957_0001679 3300044842 Bacteria 11631
119 Ga0466957_0033086 3300044842 Bacteria 3100
120 Ga0466959_0000056 3300045049 Bacteria 78465
121 Ga0495627_002875 3300046453 Bacteria 7939
122 Ga0495633_0000005 3300046558 Bacteria 357644
123 Ga0495668_0002497 3300046616 Bacteria 15047
124 Ga0496121_0000020 3300048924 Bacteria 498732
125 Ga0496124_0028981 3300048927 Bacteria 4942
126 Ga0496126_0007895 3300048929 Bacteria 11585
127 Ga0501034_0000017 3300049571 Bacteria 285938
128 Ga0501034_0071456 3300049571 Bacteria 3480
129 Ga0501034_0200886 3300049571 Bacteria 1952
130 Ga0501034_0300212 3300049571 Bacteria 1543
131 Ga0501047_0047393 3300049581 Bacteria 4152
132 Ga0501047_0077125 3300049581 Bacteria 3207
133 Ga0501241_000926 3300049758 Bacteria 6227
134 Ga0501044_0003293 3300049823 Bacteria 18191
135 Ga0501044_0020810 3300049823 Bacteria 7002
136 Ga0501044_0118910 3300049823 Bacteria 2645
137 nmdc:mga05p37_4450_c1 3300050507 Bacteria 16377
138 Ga0500578_0001630 3300053086 Bacteria 21717
139 Ga0500646_0013924 3300053090 Bacteria 2085
140 Ga0500583_0000047 3300053092 Bacteria 78958
141 Ga0500651_0037400 3300053093 Bacteria 3059
142 Ga0500607_099384 3300053121 Bacteria 1448
143 Ga0500652_000909 3300053131 Bacteria 9751
144 Ga0500559_0018869 3300053136 Bacteria 2914
145 Ga0500588_0006509 3300053146 Bacteria 2652
146 Ga0500616_0039457 3300053153 Bacteria 2546
147 Ga0500622_0001441 3300053156 Bacteria 19054
148 Ga0500622_0001887 3300053156 Bacteria 15831

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0020810 Ga0501044_0020810_209_1621 385
2 3300005354 Ga0070675_100002335 Ga0070675_1000023359 399
3 3300005364 Ga0070673_100284951 Ga0070673_1002849511 399
4 3300025960 Ga0207651_10228558 Ga0207651_102285581 399
5 iso_pu_bacteria 2914759650 2914760083 407
6 3300038443 Ga0395901_0003274 Ga0395901_0003274_13726_14985 409
7 3300042876 Ga0451577_0027136 Ga0451577_0027136_1359_2600 409
8 iso_pu_bacteria 2738541278 2738726464 409
9 iso_pu_bacteria 2840677318 2840677369 409
10 iso_pu_bacteria 2883068021 2883072802 409
11 iso_pu_bacteria 2884791551 2884798410 409
12 iso_pu_bacteria 2896085136 2896085187 409
13 iso_pu_bacteria 2896109856 2896115112 409
14 iso_pu_bacteria 2929239360 2929241682 409
15 iso_pu_bacteria 2929921140 2929923625 409
16 3300005436 Ga0070713_100036035 Ga0070713_1000360353 410
17 3300025928 Ga0207700_10194977 Ga0207700_101949772 410
18 3300044712 Ga0453684_0089263 Ga0453684_0089263_543_1787 410
19 3300049571 Ga0501034_0000017 Ga0501034_0000017_14517_15764 410
20 iso_pu_bacteria 2818991442 2819574039 411
21 iso_pu_bacteria 2821136567 2821137355 411
22 iso_pu_bacteria 2904467357 2904467904 411
23 3300003316 rootH1_10168875 rootH1_101688751 412
24 3300003354 JGI25160J50197_1001100 JGI25160J50197_10011008 412
25 3300005338 Ga0068868_100038360 Ga0068868_1000383603 412
26 3300005364 Ga0070673_100008494 Ga0070673_1000084943 412
27 3300005366 Ga0070659_100053794 Ga0070659_1000537942 412
28 3300005539 Ga0068853_100055399 Ga0068853_1000553992 412
29 3300005543 Ga0070672_100030841 Ga0070672_1000308412 412
30 3300005563 Ga0068855_100267308 Ga0068855_1002673082 412
31 3300005564 Ga0070664_100019018 Ga0070664_1000190184 412
32 3300005616 Ga0068852_100033787 Ga0068852_1000337871 412
33 3300005618 Ga0068864_100032114 Ga0068864_1000321142 412
34 3300006237 Ga0097621_100076222 Ga0097621_1000762222 412
35 3300006237 Ga0097621_100080983 Ga0097621_1000809832 412
36 3300009094 Ga0111539_10321545 Ga0111539_103215451 412
37 3300013100 Ga0157373_10072735 Ga0157373_100727352 412
38 3300013104 Ga0157370_10020705 Ga0157370_100207053 412
39 3300013105 Ga0157369_10008242 Ga0157369_1000824210 412
40 3300013297 Ga0157378_10020000 Ga0157378_100200003 412
41 3300013306 Ga0163162_10027218 Ga0163162_100272182 412
42 3300014969 Ga0157376_10073078 Ga0157376_100730782 412
43 3300014969 Ga0157376_10148050 Ga0157376_101480502 412
44 3300025302 Ga0207426_1000023 Ga0207426_1000023160 412
45 3300025903 Ga0207680_10146473 Ga0207680_101464731 412
46 3300025926 Ga0207659_10029063 Ga0207659_100290632 412
47 3300025932 Ga0207690_10017605 Ga0207690_100176052 412
48 3300025940 Ga0207691_10059788 Ga0207691_100597882 412
49 3300025949 Ga0207667_10220513 Ga0207667_102205132 412
50 3300026041 Ga0207639_10047304 Ga0207639_100473042 412
51 3300026116 Ga0207674_10048645 Ga0207674_100486452 412
52 3300026142 Ga0207698_10298590 Ga0207698_102985901 412
53 3300031251 Ga0265327_10000030 Ga0265327_10000030199 412
54 3300031251 Ga0265327_10054940 Ga0265327_100549402 412
55 3300002738 JGI25154J39366_1000014 JGI25154J39366_1000014184 413
56 3300003215 JGI25153J46596_10001718 JGI25153J46596_1000171811 413
57 3300003215 JGI25153J46596_10010173 JGI25153J46596_100101734 413
58 3300003316 rootH1_10014739 rootH1_100147392 413
59 3300003322 rootL2_10055158 rootL2_100551582 413
60 3300003323 rootH1_10160499 rootH1_101604992 413
61 3300003323 rootH1_10201000 rootH1_102010002 413
62 3300003323 rootH1_10250213 rootH1_102502132 413
63 3300003762 Ga0055542_1009820 Ga0055542_10098202 413
64 3300003790 Ga0055528_1001076 Ga0055528_10010769 413
65 3300003791 Ga0055530_10000480 Ga0055530_100004801 413
66 3300003794 Ga0055531_10000093 Ga0055531_1000009332 413
67 3300005262 Ga0065165_1000036 Ga0065165_100003636 413
68 3300005262 Ga0065165_1005970 Ga0065165_10059702 413
69 3300005289 Ga0065704_10079820 Ga0065704_100798203 413
70 3300005334 Ga0068869_100024446 Ga0068869_1000244462 413
71 3300005530 Ga0070679_100001490 Ga0070679_10000149012 413
72 3300005539 Ga0068853_100032286 Ga0068853_1000322862 413
73 3300005548 Ga0070665_100268627 Ga0070665_1002686271 413
74 3300005563 Ga0068855_100060433 Ga0068855_1000604333 413
75 3300005563 Ga0068855_100108937 Ga0068855_1001089372 413
76 3300005578 Ga0068854_100081691 Ga0068854_1000816912 413
77 3300005616 Ga0068852_100013686 Ga0068852_1000136862 413
78 3300005843 Ga0068860_100006943 Ga0068860_1000069436 413
79 3300005843 Ga0068860_100064541 Ga0068860_1000645412 413
80 3300005843 Ga0068860_100149998 Ga0068860_1001499982 413
81 3300005844 Ga0068862_100234410 Ga0068862_1002344102 413
82 3300009094 Ga0111539_10018486 Ga0111539_100184863 413
83 3300009147 Ga0114129_10006710 Ga0114129_100067109 413
84 3300009174 Ga0105241_10009065 Ga0105241_100090659 413
85 3300009545 Ga0105237_10011720 Ga0105237_100117206 413
86 3300009545 Ga0105237_10045382 Ga0105237_100453824 413
87 3300010375 Ga0105239_10039187 Ga0105239_100391875 413
88 3300010375 Ga0105239_10078063 Ga0105239_100780634 413
89 3300013100 Ga0157373_10040132 Ga0157373_100401323 413
90 3300013102 Ga0157371_10052771 Ga0157371_100527712 413
91 3300015265 Ga0182005_1000039 Ga0182005_100003970 413
92 3300025208 Ga0209436_102525 Ga0209436_1025253 413
93 3300025242 Ga0209258_100195 Ga0209258_10019523 413
94 3300025246 Ga0209646_1000002 Ga0209646_1000002941 413
95 3300025250 Ga0209026_1000178 Ga0209026_100017826 413
96 3300025254 Ga0209148_1000515 Ga0209148_10005156 413
97 3300025273 Ga0209673_1000261 Ga0209673_100026178 413
98 3300025295 Ga0209564_1031343 Ga0209564_10313432 413
99 3300025297 Ga0209758_1004617 Ga0209758_10046173 413
100 3300025297 Ga0209758_1038377 Ga0209758_10383773 413
101 3300025298 Ga0209050_1000160 Ga0209050_100016026 413
102 3300025302 Ga0207426_1000360 Ga0207426_100036011 413
103 3300025302 Ga0207426_1001116 Ga0207426_100111615 413
104 3300025302 Ga0207426_1013538 Ga0207426_10135384 413
105 3300025304 Ga0209257_1000001 Ga0209257_1000001928 413
106 3300025304 Ga0209257_1003010 Ga0209257_100301010 413
107 3300025909 Ga0207705_10029234 Ga0207705_100292342 413
108 3300025909 Ga0207705_10061868 Ga0207705_100618682 413
109 3300025911 Ga0207654_10093556 Ga0207654_100935562 413
110 3300025913 Ga0207695_10110289 Ga0207695_101102892 413
111 3300025914 Ga0207671_10000102 Ga0207671_1000010216 413
112 3300025914 Ga0207671_10098352 Ga0207671_100983522 413
113 3300025921 Ga0207652_10000765 Ga0207652_1000076515 413
114 3300025942 Ga0207689_10036167 Ga0207689_100361673 413
115 3300025949 Ga0207667_10045484 Ga0207667_100454843 413
116 3300025949 Ga0207667_10073006 Ga0207667_100730062 413
117 3300026078 Ga0207702_10036570 Ga0207702_100365701 413
118 3300028380 Ga0268265_10112524 Ga0268265_101125243 413
119 3300028380 Ga0268265_10216509 Ga0268265_102165092 413
120 3300028381 Ga0268264_10051023 Ga0268264_100510233 413
121 3300028381 Ga0268264_10127315 Ga0268264_101273152 413
122 3300028381 Ga0268264_10140016 Ga0268264_101400161 413
123 3300031251 Ga0265327_10042335 Ga0265327_100423352 413
124 3300035695 Ga0373927_0056252 Ga0373927_0056252_11_1267 413
125 3300039437 Ga0436365_1457825 Ga0436365_1457825_395_1669 413
126 3300041997 Ga0439431_0000897 Ga0439431_0000897_4646_5893 413
127 3300042004 Ga0439445_0005210 Ga0439445_0005210_209_1456 413
128 3300042007 Ga0439449_0009170 Ga0439449_0009170_1959_3215 413
129 3300044658 Ga0466972_0000038 Ga0466972_0000038_131885_133141 413
130 3300044684 Ga0466966_0001759 Ga0466966_0001759_6794_8053 413
131 3300044712 Ga0453684_0219825 Ga0453684_0219825_653_1906 413
132 3300044842 Ga0466957_0001679 Ga0466957_0001679_4961_6217 413
133 3300044842 Ga0466957_0033086 Ga0466957_0033086_1774_3030 413
134 3300045049 Ga0466959_0000056 Ga0466959_0000056_18261_19520 413
135 3300046453 Ga0495627_002875 Ga0495627_002875_3825_5081 413
136 3300046558 Ga0495633_0000005 Ga0495633_0000005_194614_195870 413
137 3300046616 Ga0495668_0002497 Ga0495668_0002497_4459_5715 413
138 3300048924 Ga0496121_0000020 Ga0496121_0000020_3002_4252 413
139 3300048927 Ga0496124_0028981 Ga0496124_0028981_1333_2616 413
140 3300048929 Ga0496126_0007895 Ga0496126_0007895_6139_7395 413
141 3300049571 Ga0501034_0071456 Ga0501034_0071456_470_1717 413
142 3300049571 Ga0501034_0200886 Ga0501034_0200886_634_1896 413
143 3300049571 Ga0501034_0300212 Ga0501034_0300212_103_1359 413
144 3300049581 Ga0501047_0047393 Ga0501047_0047393_1206_2468 413
145 3300049581 Ga0501047_0077125 Ga0501047_0077125_138_1394 413
146 3300049758 Ga0501241_000926 Ga0501241_000926_4494_5750 413
147 3300049823 Ga0501044_0003293 Ga0501044_0003293_7302_8558 413
148 3300049823 Ga0501044_0118910 Ga0501044_0118910_301_1563 413
149 3300050507 nmdc:mga05p37_4450_c1 nmdc:mga05p37_4450_c1_6372_7628 413
150 3300053086 Ga0500578_0001630 Ga0500578_0001630_18682_19938 413
151 3300053090 Ga0500646_0013924 Ga0500646_0013924_327_1583 413
152 3300053092 Ga0500583_0000047 Ga0500583_0000047_66477_67733 413
153 3300053093 Ga0500651_0037400 Ga0500651_0037400_257_1513 413
154 3300053121 Ga0500607_099384 Ga0500607_099384_97_1353 413
155 3300053131 Ga0500652_000909 Ga0500652_000909_7762_9051 413
156 3300053136 Ga0500559_0018869 Ga0500559_0018869_1019_2275 413
157 3300053146 Ga0500588_0006509 Ga0500588_0006509_1079_2344 413
158 3300053153 Ga0500616_0039457 Ga0500616_0039457_716_1972 413
159 3300053156 Ga0500622_0001441 Ga0500622_0001441_7024_8301 413
160 3300053156 Ga0500622_0001887 Ga0500622_0001887_213_1469 413
161 iso_pu_bacteria 2818991444 2819586726 413
162 iso_pu_bacteria 2929154850 2929155404 413
163 iso_pu_bacteria 8003151029 8003155241 413

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02464

CinA

Competence-damaged protein

328

482

0.98

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

75

242

0.96

PF18146

CinA_KH

Damage-inducible protein CinA KH domain

251

322

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kvk-assembly1.cif.gz_A-2 crystal structure of the competence-damaged protein (cina) superfamily protein kp700603 from klebsiella pneumoniae 700603 0.9703 262 411
5kol-assembly2.cif.gz_D crystal structure of the competence-damaged protein (cina) superfamily protein eck1530/ec0983 from escherichia coli 0.9651 262 413
5v01-assembly1.cif.gz_B crystal structure of the competence damage-inducible protein a (coma) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.9439 260 411
2a9s-assembly1.cif.gz_B the crystal structure of competence/damage inducible protein ciha from agrobacterium tumefaciens 0.9407 260 412
6l19-assembly1.cif.gz_B the crystal structure of competence or damage-inducible protein from enterobacter asburiae 0.9363 259 412
ID Description Score Start End Superfamily
af_P0A6G3_1_161_3.90.950.20 Alpha Beta;Alpha-Beta Complex;Maf protein;CinA-like 0.9846 262 413 3.90.950.20
af_P9WPE3_267_424_3.90.950.20 Alpha Beta;Alpha-Beta Complex;Maf protein;CinA-like 0.9673 259 411 3.90.950.20
af_Q2FZ10_1_167_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.962 5 169 3.40.980.10
af_P77808_2_172_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9521 4 173 3.40.980.10
af_Q2FZ10_1_167_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9453 5 169 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A2T4DLS9-F1-model_v4 deleted 1.003 263 356
AF-A0A090SIP4-F1-model_v4 C-terminal domain of CinA type S 0.9993 262 342
AF-A0A7V5G4W5-F1-model_v4 CinA family protein 0.9964 263 339
AF-A0A522PBI7-F1-model_v4 CinA family protein 0.9941 262 412
AF-A0A6P2Z337-F1-model_v4 deleted 0.9935 262 412

Feature Viewer

pLDDT pTM Quality
94.61 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map