F241851

General Info

Members Datasets Scaffolds Average Seq Length
163 121 157 383

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10012031|Ga0207648_100120314
Length 407
Sequence LKPLENIFPPSGPNMRPNKIRDEMKAITEQQFATIDHLNHILQHLKDQFVGKDEIIDLMGICLAGRENLFLLGPPGTAKSAMVRELSKLLNGKTFEYLLTRFTEPNELFGPFDIRKLREGDLITNTEGMLPEANLIFLDELLNANSAILNSLLMVLNEKVFRRGRENRPLPVIMIVGASNHLPEDEALHALFDRFLVRVKCENVDPALLNNVLEAGWKLEQKKMIDSPEILAEDIVKIQSLIGSIDLQDIRPAYINLVETLRNAGVQVSDRRAVKLQRLIAASALLCKRSKAIPSDMWVMRFIWDTEEQQEVIAGIVNNVVEADKESPNQHPRASVHALPNADEIFKEVTMMSEKWEDQALPMMERTVIKDRLRYLSGRCEWISNSVQRKFVQEPIDTLWKKIIHSD

Samples

Sample ID Description Type Environment
1 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
4 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
5 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
6 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
7 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
82 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
116 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
117 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
118 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
119 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
120 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
121 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.71
Metatranscriptomes 0
Isolates 4.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.56
Nodule 0
Rhizoplane 0
Rhizosphere 71.17
Stem 0
Stem Tuber 0
Unclassified 12.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000145 3300002737 Bacteria 77086
2 JGI25164J39214_1002276 3300002772 Bacteria 3101
3 JGI25165J46597_1001188 3300003214 Bacteria 15874
4 rootH1_10119326 3300003316 Unclassified 2658
5 rootH1_10132622 3300003316 Bacteria 3387
6 rootH1_10132622 3300003323 Bacteria 1660
7 rootH1_10141260 3300003316 Bacteria 1623
8 rootL2_10046732 3300003322 Bacteria 26640
9 rootL2_10104994 3300003322 Bacteria 3051
10 rootL2_10231225 3300003322 Unclassified 3573
11 rootH1_10002275 3300003323 Bacteria 51459
12 rootH1_10073929 3300003323 Bacteria 14411
13 rootH1_10176890 3300003323 Bacteria 3701
14 JGI25160J50197_1003441 3300003354 Bacteria 7080
15 Ga0055535_1001557 3300003761 Bacteria 11182
16 Ga0055542_1005175 3300003762 Unclassified 2997
17 Ga0055531_10000145 3300003794 Bacteria 81767
18 Ga0065165_1001654 3300005262 Bacteria 22603
19 Ga0065714_10008121 3300005288 Bacteria 5598
20 Ga0068869_100036443 3300005334 Unclassified 3493
21 Ga0070689_100276829 3300005340 Bacteria 1391
22 Ga0070674_100029572 3300005356 Bacteria 3611
23 Ga0068867_100004651 3300005459 Bacteria 9657
24 Ga0070672_100185022 3300005543 Unclassified 1737
25 Ga0070665_100000003 3300005548 Bacteria 811857
26 Ga0068855_100049231 3300005563 Bacteria 4971
27 Ga0068857_100016499 3300005577 Bacteria 6472
28 Ga0068864_100009724 3300005618 Bacteria 7933
29 Ga0068863_100085576 3300005841 Unclassified 2987
30 Ga0068860_100049571 3300005843 Unclassified 3999
31 Ga0081455_10047269 3300005937 Unclassified 3728
32 Ga0075428_100358874 3300006844 Unclassified 1563
33 Ga0075430_100110840 3300006846 Bacteria 2288
34 Ga0075429_100022953 3300006880 Bacteria 5409
35 Ga0105240_10000064 3300009093 Bacteria 215932
36 Ga0105240_10000147 3300009093 Bacteria 142340
37 Ga0105240_10000168 3300009093 Bacteria 133212
38 Ga0105240_10092083 3300009093 Unclassified 3702
39 Ga0105240_10342050 3300009093 Bacteria 1699
40 Ga0111539_10208903 3300009094 Bacteria 2275
41 Ga0111539_10346608 3300009094 Bacteria 1729
42 Ga0105237_10000052 3300009545 Bacteria 160459
43 Ga0105237_10010674 3300009545 Bacteria 9752
44 Ga0105237_10063720 3300009545 Bacteria 3684
45 Ga0105238_10001645 3300009551 Bacteria 22403
46 Ga0105238_10032451 3300009551 Bacteria 5314
47 Ga0105238_10383512 3300009551 Unclassified 1397
48 Ga0105249_10030097 3300009553 Bacteria 4905
49 Ga0105239_10000004 3300010375 Bacteria 532483
50 Ga0105239_10001655 3300010375 Bacteria 29379
51 Ga0105239_10008157 3300010375 Bacteria 11949
52 Ga0105239_10039137 3300010375 Bacteria 5195
53 Ga0157373_10004487 3300013100 Bacteria 10505
54 Ga0157370_10364199 3300013104 Bacteria 1332
55 Ga0157369_10000614 3300013105 Bacteria 46325
56 Ga0157374_10141647 3300013296 Unclassified 2334
57 Ga0157372_10201237 3300013307 Bacteria 2307
58 Ga0163163_10000040 3300014325 Bacteria 147484
59 Ga0163163_10042973 3300014325 Unclassified 4428
60 Ga0157380_10038650 3300014326 Bacteria 3706
61 Ga0182007_10000059 3300015262 Bacteria 88462
62 Ga0182005_1000189 3300015265 Bacteria 42264
63 Ga0163161_10185291 3300017792 Bacteria 1598
64 Ga0207427_100219 3300025231 Bacteria 49678
65 Ga0209437_100225 3300025233 Bacteria 100605
66 Ga0209437_100363 3300025233 Bacteria 49686
67 Ga0209258_100315 3300025242 Bacteria 75151
68 Ga0209148_1000322 3300025254 Bacteria 66549
69 Ga0209233_1000017 3300025261 Bacteria 898076
70 Ga0209455_1011182 3300025272 Bacteria 2227
71 Ga0207426_1000026 3300025302 Bacteria 515228
72 Ga0209257_1000013 3300025304 Bacteria 1047305
73 Ga0207695_10000023 3300025913 Bacteria 657903
74 Ga0207695_10000031 3300025913 Bacteria 526801
75 Ga0207695_10000046 3300025913 Bacteria 430344
76 Ga0207695_10000149 3300025913 Bacteria 207941
77 Ga0207695_10071276 3300025913 Bacteria 3549
78 Ga0207695_10094544 3300025913 Unclassified 2996
79 Ga0207671_10004256 3300025914 Bacteria 13775
80 Ga0207671_10085516 3300025914 Bacteria 2370
81 Ga0207694_10005418 3300025924 Bacteria 9819
82 Ga0207694_10029758 3300025924 Unclassified 4168
83 Ga0207670_10218791 3300025936 Bacteria 1457
84 Ga0207689_10026834 3300025942 Bacteria 4822
85 Ga0207667_10131516 3300025949 Bacteria 2578
86 Ga0207667_10365617 3300025949 Bacteria 1471
87 Ga0207639_10003741 3300026041 Bacteria 10240
88 Ga0207639_10009481 3300026041 Bacteria 6718
89 Ga0207648_10012031 3300026089 Bacteria 8118
90 Ga0207676_10019327 3300026095 Unclassified 4968
91 Ga0207674_10015521 3300026116 Bacteria 8367
92 Ga0207675_100276859 3300026118 Unclassified 1629
93 Ga0268266_10000052 3300028379 Bacteria 296230
94 Ga0268264_10090850 3300028381 Unclassified 2633
95 Ga0265338_10000390 3300028800 Bacteria 78634
96 Ga0265324_10036580 3300029957 Bacteria 1707
97 Ga0265327_10000073 3300031251 Bacteria 214772
98 Ga0265327_10048635 3300031251 Bacteria 2229
99 Ga0307405_10000066 3300031731 Bacteria 48667
100 Ga0307409_100166964 3300031995 Bacteria 1933
101 Ga0307510_10004468 3300033180 Bacteria 16452
102 Ga0373961_0031541 3300035241 Bacteria 1481
103 Ga0373927_0010946 3300035695 Bacteria 6038
104 Ga0373925_0000813 3300037068 Bacteria 28757
105 Ga0439436_0002365 3300041404 Bacteria 5652
106 Ga0451853_3247153 3300041512 Bacteria 3379
107 Ga0451577_0304794 3300042876 Bacteria 1443
108 Ga0466965_0030167 3300044683 Bacteria 2641
109 Ga0466961_0162904 3300044693 Bacteria 1390
110 Ga0453684_0004308 3300044712 Bacteria 30321
111 Ga0453684_0016338 3300044712 Bacteria 11616
112 Ga0466957_0001475 3300044842 Bacteria 12337
113 Ga0466957_0003996 3300044842 Bacteria 8155
114 Ga0451576_0000020 3300045051 Bacteria 529568
115 Ga0451576_0134487 3300045051 Bacteria 2578
116 Ga0451576_0173541 3300045051 Bacteria 2250
117 Ga0495610_0000049 3300046512 Bacteria 149009
118 Ga0495628_0057560 3300046516 Bacteria 3058
119 Ga0495630_0000478 3300046517 Bacteria 29932
120 Ga0495632_0067735 3300046519 Bacteria 1721
121 Ga0495645_0047213 3300046543 Unclassified 3138
122 Ga0495633_0000152 3300046558 Bacteria 91044
123 Ga0495667_0136081 3300046559 Bacteria 1584
124 Ga0495611_0000100 3300046648 Bacteria 59688
125 Ga0495625_0033027 3300046660 Bacteria 3831
126 Ga0495599_0003806 3300046678 Bacteria 8857
127 Ga0495624_0109450 3300046690 Bacteria 1699
128 Ga0495581_0053326 3300047315 Bacteria 2336
129 Ga0495604_0157165 3300047317 Bacteria 1609
130 Ga0495686_0000234 3300047472 Bacteria 101539
131 Ga0496121_0000007 3300048924 Bacteria 942516
132 Ga0496126_0012686 3300048929 Bacteria 8622
133 Ga0501034_0001340 3300049571 Bacteria 33293
134 Ga0501043_0041497 3300049579 Bacteria 3615
135 Ga0501046_0045462 3300049580 Bacteria 3488
136 Ga0501046_0067408 3300049580 Bacteria 2787
137 Ga0501047_0001561 3300049581 Bacteria 22417
138 Ga0501047_0060030 3300049581 Bacteria 3671
139 Ga0501070_0000890 3300049586 Bacteria 27159
140 Ga0501225_0001021 3300049705 Bacteria 8783
141 Ga0501044_0216760 3300049823 Bacteria 1866
142 nmdc:mga09592_16905_c1 3300050508 Bacteria 5969
143 nmdc:mga0qj67_191737_c1 3300050509 Bacteria 1661
144 nmdc:mga0qj67_29802_c1 3300050509 Bacteria 4240
145 nmdc:mga08y16_375880_c1 3300050511 Bacteria 1457
146 nmdc:mga08y16_518435_c1 3300050511 Bacteria 1209
147 Ga0495601_0011884 3300053077 Bacteria 5219
148 Ga0500578_0013502 3300053086 Bacteria 5261
149 Ga0500644_0000070 3300053088 Bacteria 61261
150 Ga0500618_002360 3300053125 Bacteria 7212
151 Ga0500577_0003252 3300053142 Bacteria 4208
152 Ga0500588_0007979 3300053146 Bacteria 2456
153 Ga0500622_0000032 3300053156 Bacteria 205634
154 Ga0500622_0000036 3300053156 Bacteria 181221
155 Ga0500622_0001007 3300053156 Bacteria 23773
156 Ga0500622_0002477 3300053156 Bacteria 13297
157 Ga0500622_0007781 3300053156 Bacteria 6045

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0001561 Ga0501047_0001561_14581_15747 357
2 3300003322 rootL2_10104994 rootL2_101049943 365
3 3300006844 Ga0075428_100358874 Ga0075428_1003588742 365
4 3300049580 Ga0501046_0067408 Ga0501046_0067408_893_2014 369
5 3300031995 Ga0307409_100166964 Ga0307409_1001669642 372
6 iso_pu_bacteria 2929239360 2929242633 373
7 3300003323 rootH1_10073929 rootH1_100739299 374
8 3300053156 Ga0500622_0001007 Ga0500622_0001007_10054_11181 374
9 3300009093 Ga0105240_10000147 Ga0105240_1000014727 375
10 3300009093 Ga0105240_10000168 Ga0105240_1000016822 375
11 3300009093 Ga0105240_10092083 Ga0105240_100920833 375
12 3300009545 Ga0105237_10000052 Ga0105237_1000005221 375
13 3300010375 Ga0105239_10039137 Ga0105239_100391372 375
14 3300025913 Ga0207695_10000023 Ga0207695_10000023280 375
15 3300025913 Ga0207695_10000031 Ga0207695_10000031289 375
16 3300025913 Ga0207695_10094544 Ga0207695_100945442 375
17 3300025914 Ga0207671_10004256 Ga0207671_100042564 375
18 3300031251 Ga0265327_10000073 Ga0265327_10000073128 375
19 3300033180 Ga0307510_10004468 Ga0307510_1000446810 375
20 3300044712 Ga0453684_0016338 Ga0453684_0016338_5287_6417 375
21 3300046516 Ga0495628_0057560 Ga0495628_0057560_1897_3027 375
22 3300046543 Ga0495645_0047213 Ga0495645_0047213_1372_2502 375
23 3300046648 Ga0495611_0000100 Ga0495611_0000100_33870_35000 375
24 3300047317 Ga0495604_0157165 Ga0495604_0157165_161_1291 375
25 3300047472 Ga0495686_0000234 Ga0495686_0000234_30644_31774 375
26 3300053077 Ga0495601_0011884 Ga0495601_0011884_3366_4496 375
27 3300005340 Ga0070689_100276829 Ga0070689_1002768291 376
28 3300005577 Ga0068857_100016499 Ga0068857_1000164994 376
29 3300009094 Ga0111539_10208903 Ga0111539_102089032 376
30 3300009094 Ga0111539_10346608 Ga0111539_103466082 376
31 3300010375 Ga0105239_10008157 Ga0105239_100081576 376
32 3300014325 Ga0163163_10000040 Ga0163163_10000040105 376
33 3300025936 Ga0207670_10218791 Ga0207670_102187912 376
34 3300026041 Ga0207639_10003741 Ga0207639_100037417 376
35 3300026116 Ga0207674_10015521 Ga0207674_100155213 376
36 3300028800 Ga0265338_10000390 Ga0265338_1000039023 376
37 3300044683 Ga0466965_0030167 Ga0466965_0030167_542_1675 376
38 3300045051 Ga0451576_0173541 Ga0451576_0173541_58_1191 376
39 3300046678 Ga0495599_0003806 Ga0495599_0003806_1323_2456 376
40 3300050511 nmdc:mga08y16_375880_c1 nmdc:mga08y16_375880_c1_150_1283 376
41 3300050511 nmdc:mga08y16_518435_c1 nmdc:mga08y16_518435_c1_16_1152 376
42 3300009551 Ga0105238_10383512 Ga0105238_103835122 377
43 3300046559 Ga0495667_0136081 Ga0495667_0136081_413_1549 377
44 iso_pu_bacteria 2818991442 2819574563 377
45 iso_pu_bacteria 2821136567 2821137937 377
46 iso_pu_bacteria 2904467357 2904468730 377
47 3300009093 Ga0105240_10000064 Ga0105240_10000064104 378
48 3300025913 Ga0207695_10000046 Ga0207695_1000004673 378
49 3300031251 Ga0265327_10048635 Ga0265327_100486352 378
50 3300029957 Ga0265324_10036580 Ga0265324_100365802 379
51 iso_pu_bacteria 2842722452 2842727500 379
52 3300003316 rootH1_10119326 rootH1_101193262 380
53 3300003322 rootL2_10231225 rootL2_102312252 380
54 3300005618 Ga0068864_100009724 Ga0068864_1000097241 380
55 3300005841 Ga0068863_100085576 Ga0068863_1000855763 380
56 3300013296 Ga0157374_10141647 Ga0157374_101416473 380
57 3300014325 Ga0163163_10042973 Ga0163163_100429732 380
58 3300026095 Ga0207676_10019327 Ga0207676_100193272 380
59 3300045051 Ga0451576_0134487 Ga0451576_0134487_34_1191 380
60 iso_pu_bacteria 2684623219 2687234998 380
61 3300002772 JGI25164J39214_1002276 JGI25164J39214_10022761 381
62 3300003214 JGI25165J46597_1001188 JGI25165J46597_10011886 381
63 3300003316 rootH1_10141260 rootH1_101412602 381
64 3300005262 Ga0065165_1001654 Ga0065165_100165415 381
65 3300005548 Ga0070665_100000003 Ga0070665_100000003554 381
66 3300005937 Ga0081455_10047269 Ga0081455_100472693 381
67 3300009093 Ga0105240_10342050 Ga0105240_103420502 381
68 3300009551 Ga0105238_10032451 Ga0105238_100324513 381
69 3300015265 Ga0182005_1000189 Ga0182005_100018943 381
70 3300025231 Ga0207427_100219 Ga0207427_10021940 381
71 3300025233 Ga0209437_100363 Ga0209437_10036340 381
72 3300025261 Ga0209233_1000017 Ga0209233_1000017798 381
73 3300025913 Ga0207695_10071276 Ga0207695_100712764 381
74 3300025914 Ga0207671_10085516 Ga0207671_100855163 381
75 3300025924 Ga0207694_10029758 Ga0207694_100297583 381
76 3300026041 Ga0207639_10009481 Ga0207639_100094813 381
77 3300028379 Ga0268266_10000052 Ga0268266_10000052146 381
78 3300048924 Ga0496121_0000007 Ga0496121_0000007_311899_313047 381
79 3300003761 Ga0055535_1001557 Ga0055535_10015574 382
80 3300003762 Ga0055542_1005175 Ga0055542_10051752 382
81 3300025242 Ga0209258_100315 Ga0209258_10031535 382
82 3300025254 Ga0209148_1000322 Ga0209148_100032234 382
83 3300046519 Ga0495632_0067735 Ga0495632_0067735_288_1436 382
84 3300053088 Ga0500644_0000070 Ga0500644_0000070_21320_22468 382
85 3300053125 Ga0500618_002360 Ga0500618_002360_1842_2990 382
86 3300053142 Ga0500577_0003252 Ga0500577_0003252_226_1374 382
87 3300003316 rootH1_10132622 rootH1_101326222 383
88 3300003322 rootL2_10046732 rootL2_1004673212 383
89 3300003323 rootH1_10176890 rootH1_101768902 383
90 3300003354 JGI25160J50197_1003441 JGI25160J50197_10034415 383
91 3300003794 Ga0055531_10000145 Ga0055531_100001452 383
92 3300005288 Ga0065714_10008121 Ga0065714_100081212 383
93 3300006846 Ga0075430_100110840 Ga0075430_1001108402 383
94 3300006880 Ga0075429_100022953 Ga0075429_1000229532 383
95 3300013100 Ga0157373_10004487 Ga0157373_100044872 383
96 3300013105 Ga0157369_10000614 Ga0157369_1000061445 383
97 3300015262 Ga0182007_10000059 Ga0182007_1000005953 383
98 3300025302 Ga0207426_1000026 Ga0207426_100002626 383
99 3300025304 Ga0209257_1000013 Ga0209257_1000013135 383
100 3300031731 Ga0307405_10000066 Ga0307405_100000669 383
101 3300042876 Ga0451577_0304794 Ga0451577_0304794_125_1276 383
102 3300044712 Ga0453684_0004308 Ga0453684_0004308_9895_11046 383
103 3300046512 Ga0495610_0000049 Ga0495610_0000049_32014_33165 383
104 3300048929 Ga0496126_0012686 Ga0496126_0012686_7307_8458 383
105 3300049571 Ga0501034_0001340 Ga0501034_0001340_17381_18544 383
106 3300050508 nmdc:mga09592_16905_c1 nmdc:mga09592_16905_c1_3549_4700 383
107 3300050509 nmdc:mga0qj67_191737_c1 nmdc:mga0qj67_191737_c1_355_1506 383
108 3300053156 Ga0500622_0000032 Ga0500622_0000032_95962_97113 383
109 3300053156 Ga0500622_0000036 Ga0500622_0000036_39281_40432 383
110 3300053156 Ga0500622_0002477 Ga0500622_0002477_10658_11809 383
111 3300002737 JGI25162J39368_1000145 JGI25162J39368_100014519 384
112 3300003323 rootH1_10002275 rootH1_1000227535 384
113 3300005334 Ga0068869_100036443 Ga0068869_1000364432 384
114 3300005356 Ga0070674_100029572 Ga0070674_1000295723 384
115 3300005459 Ga0068867_100004651 Ga0068867_1000046513 384
116 3300005543 Ga0070672_100185022 Ga0070672_1001850222 384
117 3300005563 Ga0068855_100049231 Ga0068855_1000492313 384
118 3300005843 Ga0068860_100049571 Ga0068860_1000495713 384
119 3300009545 Ga0105237_10010674 Ga0105237_100106747 384
120 3300009545 Ga0105237_10063720 Ga0105237_100637203 384
121 3300009551 Ga0105238_10001645 Ga0105238_100016453 384
122 3300009553 Ga0105249_10030097 Ga0105249_100300972 384
123 3300010375 Ga0105239_10000004 Ga0105239_10000004217 384
124 3300010375 Ga0105239_10001655 Ga0105239_100016553 384
125 3300013104 Ga0157370_10364199 Ga0157370_103641992 384
126 3300013307 Ga0157372_10201237 Ga0157372_102012372 384
127 3300014326 Ga0157380_10038650 Ga0157380_100386503 384
128 3300017792 Ga0163161_10185291 Ga0163161_101852912 384
129 3300025233 Ga0209437_100225 Ga0209437_10022527 384
130 3300025272 Ga0209455_1011182 Ga0209455_10111822 384
131 3300025913 Ga0207695_10000149 Ga0207695_10000149162 384
132 3300025924 Ga0207694_10005418 Ga0207694_100054183 384
133 3300025942 Ga0207689_10026834 Ga0207689_100268343 384
134 3300025949 Ga0207667_10131516 Ga0207667_101315162 384
135 3300025949 Ga0207667_10365617 Ga0207667_103656172 384
136 3300026089 Ga0207648_10012031 Ga0207648_100120314 384
137 3300026118 Ga0207675_100276859 Ga0207675_1002768592 384
138 3300028381 Ga0268264_10090850 Ga0268264_100908502 384
139 3300035241 Ga0373961_0031541 Ga0373961_0031541_123_1292 384
140 3300035695 Ga0373927_0010946 Ga0373927_0010946_2212_3381 384
141 3300037068 Ga0373925_0000813 Ga0373925_0000813_8380_9549 384
142 3300041404 Ga0439436_0002365 Ga0439436_0002365_1078_2232 384
143 3300041512 Ga0451853_3247153 Ga0451853_3247153_2195_3349 384
144 3300044693 Ga0466961_0162904 Ga0466961_0162904_68_1222 384
145 3300044842 Ga0466957_0001475 Ga0466957_0001475_4484_5638 384
146 3300044842 Ga0466957_0003996 Ga0466957_0003996_2959_4113 384
147 3300045051 Ga0451576_0000020 Ga0451576_0000020_390738_391904 384
148 3300046517 Ga0495630_0000478 Ga0495630_0000478_27790_28953 384
149 3300046558 Ga0495633_0000152 Ga0495633_0000152_45402_46556 384
150 3300046660 Ga0495625_0033027 Ga0495625_0033027_2309_3463 384
151 3300046690 Ga0495624_0109450 Ga0495624_0109450_196_1359 384
152 3300047315 Ga0495581_0053326 Ga0495581_0053326_117_1280 384
153 3300049579 Ga0501043_0041497 Ga0501043_0041497_421_1587 384
154 3300049580 Ga0501046_0045462 Ga0501046_0045462_583_1749 384
155 3300049581 Ga0501047_0060030 Ga0501047_0060030_1747_2901 384
156 3300049586 Ga0501070_0000890 Ga0501070_0000890_3622_4788 384
157 3300049705 Ga0501225_0001021 Ga0501225_0001021_5917_7071 384
158 3300049823 Ga0501044_0216760 Ga0501044_0216760_104_1270 384
159 3300050509 nmdc:mga0qj67_29802_c1 nmdc:mga0qj67_29802_c1_156_1346 384
160 3300053086 Ga0500578_0013502 Ga0500578_0013502_4065_5219 384
161 3300053146 Ga0500588_0007979 Ga0500588_0007979_710_1867 384
162 3300053156 Ga0500622_0007781 Ga0500622_0007781_2174_3367 384
163 iso_pu_bacteria 2738541278 2738724882 384

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20030

bpMoxR

MoxR domain in the MoxR-vWA-beta-propeller ternary systems

36

240

0.99

PF07728

AAA_5

AAA domain (dynein-related subfamily)

68

195

0.95

PF01078

Mg_chelatase

Magnesium chelatase, subunit ChlI

45

103

0.88

PF17868

AAA_lid_8

AAA lid domain

245

317

0.86

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

69

203

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r44-assembly1.cif.gz_A crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution 0.7876 6 299
3nbx-assembly1.cif.gz_X crystal structure of e. coli rava (regulatory atpase variant a) in complex with adp 0.7763 8 332
6q7m-assembly1.cif.gz_Z spiral structure of e. coli rava in the rava-ldci cage-like complex 0.757 8 334
7abr-assembly1.cif.gz_D cryo-em structure of b. subtilis clpc (dwb mutant) hexamer bound to a substrate polypeptide 0.7427 12 198
8a8u-assembly1.cif.gz_B mycobacterium tuberculosis clpc1 hexamer structure 0.735 12 198
ID Description Score Start End Superfamily
af_Q58222_1_208_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8991 18 223 3.40.50.300
af_Q58222_1_208_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8745 18 223 3.40.50.300
af_P71552_43_250_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8378 26 177 3.40.50.300
af_Q79FN7_37_232_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8182 13 207 3.40.50.300
3nbxX01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8156 10 217 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0Q4QG87-F1-model_v4 ATPase 0.9244 11 299
AF-A0A534RXE3-F1-model_v4 AAA family ATPase 0.9118 11 238 GO:0016887
AF-A0A351MIE4-F1-model_v4 AAA family ATPase 0.9101 11 301 GO:0016887
AF-A0A0Q4QG87-F1-model_v4 ATPase 0.9004 11 299
AF-A0A380X622-F1-model_v4 ATPase ravA (EC 3.6.3.-) 0.8972 11 300 GO:0016787

Feature Viewer

pLDDT pTM Quality
83.5 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map