F241737

General Info

Members Datasets Scaffolds Average Seq Length
163 97 326 344

Family's Representative Sequence

Representative Sequence 3300021377|Ga0213874_10004256|Ga0213874_100042562
Length 385
Sequence MRTLVAGSIQTSLFRRTSEGRGGCVYLPLPSATLIGSAVRAPTTYSDAGVNIDEADRAVSLIKRHAARTLTPDVLTSIGSFGAGFALKGWRKPVLISSADGVGTKLKIAFATGRHDTVGEDLVNHCVNDIAVQGAKPLFFLDYFAVGKLQAQVCADVVAGIARGCKNNGCALIGGETAEMPGMYAEGEYDLAGFIVGAVERKQLLTGTSIKPGDLLLGLPSNGLHTNGYSLARKILFEKSAHRMDARVDSLPGTLADELLKVHRSYLKPIMTLHDRKLLKGAAHITGGGLTDNVPRVLPKDCAVEIDPSLWPKQPIFELLGELGAVPEDDFRRTFNLGVGLVLVISAKKLTEVSRILKKLREPFYQIGQVIPRGKSQRSPRVVYL

Samples

Sample ID Description Type Environment
1 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
29 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
30 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
31 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
45 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
46 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
47 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
48 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
49 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
50 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
51 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
52 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
55 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
56 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
57 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
60 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
61 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
62 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
63 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
64 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
65 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
68 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
69 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
70 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
83 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
84 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
85 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
86 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
87 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
88 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
89 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
90 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
91 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
94 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
96 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
97 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.23
Rhizosphere 83.44
Stem 0
Stem Tuber 0
Unclassified 3.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213874_10004256 3300021377 Bacteria 3246
2 Ga0070680_100032390 3300005336 Bacteria 4208
3 Ga0070661_100050134 3300005344 Bacteria 3055
4 Ga0070673_100005892 3300005364 Bacteria 7909
5 Ga0070659_100060515 3300005366 Bacteria 2991
6 Ga0070709_10013014 3300005434 Bacteria 4669
7 Ga0070714_100025469 3300005435 Bacteria 4882
8 Ga0070714_100131262 3300005435 Bacteria 2239
9 Ga0070713_100001819 3300005436 Bacteria 13767
10 Ga0070711_100005474 3300005439 Bacteria 7595
11 Ga0070711_100377876 3300005439 Bacteria 1145
12 Ga0070663_100137805 3300005455 Unclassified 1860
13 Ga0068853_100014052 3300005539 Bacteria 6552
14 Ga0070665_100237053 3300005548 Bacteria 1825
15 Ga0070665_100475757 3300005548 Bacteria 1260
16 Ga0068855_100021201 3300005563 Bacteria 7790
17 Ga0068855_100092868 3300005563 Bacteria 3480
18 Ga0068856_100039160 3300005614 Bacteria 4654
19 Ga0081455_10025677 3300005937 Bacteria 5433
20 Ga0097621_100038682 3300006237 Bacteria 3828
21 Ga0075435_100328661 3300007076 Bacteria 1309
22 Ga0105240_10001577 3300009093 Bacteria 38667
23 Ga0105240_10043093 3300009093 Bacteria 5746
24 Ga0105240_10278546 3300009093 Bacteria 1922
25 Ga0111539_10000364 3300009094 Bacteria 55762
26 Ga0105237_10079997 3300009545 Bacteria 3258
27 Ga0105238_10231674 3300009551 Bacteria 1824
28 Ga0105239_10231487 3300010375 Bacteria 2073
29 Ga0157370_10098853 3300013104 Bacteria 2735
30 Ga0157369_10154867 3300013105 Bacteria 2421
31 Ga0157369_10155680 3300013105 Bacteria 2414
32 Ga0157374_10001458 3300013296 Bacteria 20000
33 Ga0157372_10053279 3300013307 Bacteria 4509
34 Ga0206350_11023262 3300020080 Bacteria 5029
35 Ga0213872_10000579 3300021361 Bacteria 28340
36 Ga0213876_10000941 3300021384 Bacteria 19201
37 Ga0213876_10083465 3300021384 Bacteria 1690
38 Ga0213875_10000015 3300021388 Bacteria 280499
39 Ga0213875_10000208 3300021388 Bacteria 59796
40 Ga0213875_10001971 3300021388 Bacteria 12690
41 Ga0213875_10014292 3300021388 Bacteria 3875
42 Ga0213875_10032097 3300021388 Bacteria 2483
43 Ga0213875_10032522 3300021388 Bacteria 2465
44 Ga0213875_10053387 3300021388 Bacteria 1892
45 Ga0207699_10030348 3300025906 Bacteria 3024
46 Ga0207695_10002352 3300025913 Bacteria 28101
47 Ga0207695_10021530 3300025913 Bacteria 7353
48 Ga0207695_10080539 3300025913 Bacteria 3297
49 Ga0207663_10091961 3300025916 Unclassified 2016
50 Ga0207660_10175032 3300025917 Bacteria 1663
51 Ga0207657_10041011 3300025919 Bacteria 4096
52 Ga0207649_10032633 3300025920 Bacteria 3106
53 Ga0207700_10017942 3300025928 Bacteria 4739
54 Ga0207664_10000744 3300025929 Bacteria 22168
55 Ga0207664_10125749 3300025929 Bacteria 2152
56 Ga0207690_10074188 3300025932 Bacteria 2356
57 Ga0207667_10084004 3300025949 Bacteria 3296
58 Ga0207667_10164615 3300025949 Bacteria 2280
59 Ga0207667_10186827 3300025949 Bacteria 2127
60 Ga0207651_10009599 3300025960 Bacteria 5310
61 Ga0207678_10105446 3300026067 Unclassified 2405
62 Ga0207702_10217722 3300026078 Unclassified 1778
63 Ga0207428_10000998 3300027907 Bacteria 31385
64 Ga0265338_10149498 3300028800 Bacteria 1816
65 Ga0265324_10008458 3300029957 Bacteria 4089
66 Ga0265320_10002817 3300031240 Bacteria 11964
67 Ga0265325_10013948 3300031241 Bacteria 4558
68 Ga0265325_10016762 3300031241 Bacteria 4089
69 Ga0265340_10018611 3300031247 Bacteria 3582
70 Ga0265331_10001828 3300031250 Bacteria 15074
71 Ga0265331_10024819 3300031250 Bacteria 3029
72 Ga0265316_10002004 3300031344 Bacteria 21457
73 Ga0265316_10014169 3300031344 Bacteria 7034
74 Ga0265314_10014209 3300031711 Bacteria 6385
75 Ga0316576_10021130 3300031727 Bacteria 4496
76 Ga0316583_10000021 3300032133 Bacteria 29938
77 Ga0373935_0054477 3300035692 Bacteria 2547
78 Ga0373935_0085004 3300035692 Bacteria 2062
79 Ga0373927_0247865 3300035695 Bacteria 1171
80 Ga0373947_0044739 3300035725 Bacteria 2648
81 Ga0373937_0081679 3300036401 Bacteria 2990
82 Ga0373925_0111758 3300037068 Bacteria 2112
83 Ga0436364_0236094 3300037853 Bacteria 2543
84 Ga0436364_0248845 3300037853 Bacteria 3864
85 Ga0436364_0282738 3300037853 Bacteria 17231
86 Ga0436364_0370592 3300037853 Bacteria 18758
87 Ga0436364_0678108 3300037853 Bacteria 7452
88 Ga0436364_1026124 3300037853 Bacteria 6615
89 Ga0436364_1108338 3300037853 Bacteria 5575
90 Ga0436364_1113127 3300037853 Bacteria 158393
91 Ga0436364_1121262 3300037853 Bacteria 32436
92 Ga0436364_1324064 3300037853 Bacteria 2053
93 Ga0436365_0131590 3300039437 Bacteria 14697
94 Ga0436365_0525744 3300039437 Bacteria 5949
95 Ga0436365_0921372 3300039437 Bacteria 1371
96 Ga0436365_1628423 3300039437 Bacteria 3149
97 Ga0436360_0222243 3300039438 Bacteria 17184
98 Ga0436360_1225829 3300039438 Unclassified 3511
99 Ga0436361_0754359 3300039447 Bacteria 78520
100 Ga0436363_0471629 3300039450 Bacteria 6048
101 Ga0436362_0495659 3300039453 Bacteria 2060
102 Ga0436362_1083562 3300039453 Bacteria 3797
103 Ga0466963_0083550 3300044694 Bacteria 2166
104 Ga0495618_0079563 3300046514 Bacteria 2091
105 Ga0496112_0080542 3300048915 Bacteria 3220
106 Ga0496115_0008012 3300048918 Bacteria 7796
107 Ga0501031_0005535 3300049568 Bacteria 8223
108 Ga0501031_0176592 3300049568 Bacteria 1395
109 Ga0501032_0001632 3300049569 Bacteria 17835
110 Ga0501033_0010428 3300049570 Bacteria 7126
111 Ga0501033_0016604 3300049570 Bacteria 5569
112 Ga0501034_0031823 3300049571 Bacteria 5358
113 Ga0501034_0044406 3300049571 Bacteria 4495
114 Ga0501034_0045583 3300049571 Bacteria 4430
115 Ga0501036_0003822 3300049572 Bacteria 12080
116 Ga0501036_0033353 3300049572 Bacteria 4354
117 Ga0501037_0004148 3300049573 Bacteria 10511
118 Ga0501037_0027914 3300049573 Bacteria 4171
119 Ga0501037_0044517 3300049573 Bacteria 3259
120 Ga0501038_0001584 3300049574 Bacteria 21098
121 Ga0501038_0007413 3300049574 Bacteria 10119
122 Ga0501038_0039237 3300049574 Bacteria 4143
123 Ga0501039_0006082 3300049575 Bacteria 9163
124 Ga0501043_0038683 3300049579 Bacteria 3751
125 Ga0501043_0065171 3300049579 Bacteria 2860
126 Ga0501046_0002259 3300049580 Bacteria 18182
127 Ga0501046_0054554 3300049580 Bacteria 3143
128 Ga0501046_0099857 3300049580 Bacteria 2227
129 Ga0501047_0064132 3300049581 Bacteria 3543
130 Ga0501047_0066122 3300049581 Bacteria 3485
131 Ga0501047_0112882 3300049581 Bacteria 2599
132 Ga0501047_0365357 3300049581 Bacteria 1278
133 Ga0501048_0023151 3300049582 Bacteria 4542
134 Ga0501048_0024909 3300049582 Bacteria 4365
135 Ga0501067_0013362 3300049583 Bacteria 4547
136 Ga0501067_0029354 3300049583 Bacteria 3047
137 Ga0501068_0051440 3300049584 Bacteria 2491
138 Ga0501069_0010307 3300049585 Bacteria 4947
139 Ga0501070_0006905 3300049586 Bacteria 9661
140 Ga0501070_0035825 3300049586 Bacteria 4144
141 Ga0501070_0140430 3300049586 Bacteria 1994
142 Ga0501072_0007743 3300049588 Bacteria 8154
143 Ga0501073_0000773 3300049589 Bacteria 22728
144 Ga0501073_0007781 3300049589 Bacteria 7958
145 Ga0501074_0008426 3300049590 Bacteria 7476
146 Ga0501074_0227318 3300049590 Bacteria 1328
147 Ga0501076_0203488 3300049592 Bacteria 1617
148 Ga0501076_0317232 3300049592 Bacteria 1278
149 Ga0501077_0023379 3300049593 Bacteria 3919
150 Ga0501079_0019007 3300049741 Bacteria 5249
151 Ga0501080_0001190 3300049742 Bacteria 21572
152 Ga0501080_0050283 3300049742 Bacteria 3880
153 Ga0501083_0018132 3300049744 Bacteria 4906
154 Ga0501035_0001885 3300049822 Bacteria 21113
155 Ga0501035_0043800 3300049822 Bacteria 4033
156 Ga0501035_0082749 3300049822 Bacteria 2832
157 Ga0501035_0085157 3300049822 Bacteria 2786
158 Ga0501044_0000597 3300049823 Bacteria 43761
159 Ga0501044_0004876 3300049823 Bacteria 14991
160 Ga0501044_0007147 3300049823 Bacteria 12281
161 nmdc:mga08y16_1686_c1 3300050511 Bacteria 22422
162 Ga0501082_0007929 3300060353 Bacteria 9173
163 Ga0501082_0226636 3300060353 Bacteria 1626
164 Ga0213874_10004256
165 Ga0070680_100032390
166 Ga0070661_100050134
167 Ga0070673_100005892
168 Ga0070659_100060515
169 Ga0070709_10013014
170 Ga0070714_100025469
171 Ga0070714_100131262
172 Ga0070713_100001819
173 Ga0070711_100005474
174 Ga0070711_100377876
175 Ga0070663_100137805
176 Ga0068853_100014052
177 Ga0070665_100237053
178 Ga0070665_100475757
179 Ga0068855_100021201
180 Ga0068855_100092868
181 Ga0068856_100039160
182 Ga0081455_10025677
183 Ga0097621_100038682
184 Ga0075435_100328661
185 Ga0105240_10001577
186 Ga0105240_10043093
187 Ga0105240_10278546
188 Ga0111539_10000364
189 Ga0105237_10079997
190 Ga0105238_10231674
191 Ga0105239_10231487
192 Ga0157370_10098853
193 Ga0157369_10154867
194 Ga0157369_10155680
195 Ga0157374_10001458
196 Ga0157372_10053279
197 Ga0206350_11023262
198 Ga0213872_10000579
199 Ga0213876_10000941
200 Ga0213876_10083465
201 Ga0213875_10000015
202 Ga0213875_10000208
203 Ga0213875_10001971
204 Ga0213875_10014292
205 Ga0213875_10032097
206 Ga0213875_10032522
207 Ga0213875_10053387
208 Ga0207699_10030348
209 Ga0207695_10002352
210 Ga0207695_10021530
211 Ga0207695_10080539
212 Ga0207663_10091961
213 Ga0207660_10175032
214 Ga0207657_10041011
215 Ga0207649_10032633
216 Ga0207700_10017942
217 Ga0207664_10000744
218 Ga0207664_10125749
219 Ga0207690_10074188
220 Ga0207667_10084004
221 Ga0207667_10164615
222 Ga0207667_10186827
223 Ga0207651_10009599
224 Ga0207678_10105446
225 Ga0207702_10217722
226 Ga0207428_10000998
227 Ga0265338_10149498
228 Ga0265324_10008458
229 Ga0265320_10002817
230 Ga0265325_10013948
231 Ga0265325_10016762
232 Ga0265340_10018611
233 Ga0265331_10001828
234 Ga0265331_10024819
235 Ga0265316_10002004
236 Ga0265316_10014169
237 Ga0265314_10014209
238 Ga0316576_10021130
239 Ga0316583_10000021
240 Ga0373935_0054477
241 Ga0373935_0085004
242 Ga0373927_0247865
243 Ga0373947_0044739
244 Ga0373937_0081679
245 Ga0373925_0111758
246 Ga0436364_0236094
247 Ga0436364_0248845
248 Ga0436364_0282738
249 Ga0436364_0370592
250 Ga0436364_0678108
251 Ga0436364_1026124
252 Ga0436364_1108338
253 Ga0436364_1113127
254 Ga0436364_1121262
255 Ga0436364_1324064
256 Ga0436365_0131590
257 Ga0436365_0525744
258 Ga0436365_0921372
259 Ga0436365_1628423
260 Ga0436360_0222243
261 Ga0436360_1225829
262 Ga0436361_0754359
263 Ga0436363_0471629
264 Ga0436362_0495659
265 Ga0436362_1083562
266 Ga0466963_0083550
267 Ga0495618_0079563
268 Ga0496112_0080542
269 Ga0496115_0008012
270 Ga0501031_0005535
271 Ga0501031_0176592
272 Ga0501032_0001632
273 Ga0501033_0010428
274 Ga0501033_0016604
275 Ga0501034_0031823
276 Ga0501034_0044406
277 Ga0501034_0045583
278 Ga0501036_0003822
279 Ga0501036_0033353
280 Ga0501037_0004148
281 Ga0501037_0027914
282 Ga0501037_0044517
283 Ga0501038_0001584
284 Ga0501038_0007413
285 Ga0501038_0039237
286 Ga0501039_0006082
287 Ga0501043_0038683
288 Ga0501043_0065171
289 Ga0501046_0002259
290 Ga0501046_0054554
291 Ga0501046_0099857
292 Ga0501047_0064132
293 Ga0501047_0066122
294 Ga0501047_0112882
295 Ga0501047_0365357
296 Ga0501048_0023151
297 Ga0501048_0024909
298 Ga0501067_0013362
299 Ga0501067_0029354
300 Ga0501068_0051440
301 Ga0501069_0010307
302 Ga0501070_0006905
303 Ga0501070_0035825
304 Ga0501070_0140430
305 Ga0501072_0007743
306 Ga0501073_0000773
307 Ga0501073_0007781
308 Ga0501074_0008426
309 Ga0501074_0227318
310 Ga0501076_0203488
311 Ga0501076_0317232
312 Ga0501077_0023379
313 Ga0501079_0019007
314 Ga0501080_0001190
315 Ga0501080_0050283
316 Ga0501083_0018132
317 Ga0501035_0001885
318 Ga0501035_0043800
319 Ga0501035_0082749
320 Ga0501035_0085157
321 Ga0501044_0000597
322 Ga0501044_0004876
323 Ga0501044_0007147
324 nmdc:mga08y16_1686_c1
325 Ga0501082_0007929
326 Ga0501082_0226636

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

88

199

0.96

PF02769

AIRS_C

AIR synthase related protein, C-terminal domain

211

379

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z01-assembly1.cif.gz_A crystal structure of phosphoribosylaminoimidazole synthetase from geobacillus kaustophilus 0.9636 9 335
5vk4-assembly1.cif.gz_A crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium 0.9601 5 335
5vk4-assembly1.cif.gz_B crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium 0.9559 5 335
2z01-assembly1.cif.gz_A crystal structure of phosphoribosylaminoimidazole synthetase from geobacillus kaustophilus 0.9546 9 335
5vk4-assembly1.cif.gz_A crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium 0.9543 5 335
ID Description Score Start End Superfamily
2z01A01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9638 9 155 3.30.1330.10
af_G3V918_434_598_3.30.1330.10 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9544 1 153 3.30.1330.10
2z01A01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9434 9 155 3.30.1330.10
af_P07244_618_801_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9433 160 334 3.90.650.10
af_P00967_819_956_3.30.1330.10 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9412 20 156 3.30.1330.10
ID Description Score Start End GO Terms
AF-A0A2U3K2R9-F1-model_v4 Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) 0.9782 75 335 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A1G3CZW9-F1-model_v4 Phosphoribosylformylglycinamidine cyclo-ligase (AIRS) 0.9726 47 185 GO:0004637
GO:0004641
GO:0005829
GO:0006189
GO:0046084
AF-A0A2U3K2R9-F1-model_v4 Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) 0.9708 75 335 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A4R2D768-F1-model_v4 Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) 0.9707 1 335 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A1I6ZH73-F1-model_v4 Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) 0.9707 1 335 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084

Map