F240355

General Info

Members Datasets Scaffolds Average Seq Length
162 124 162 147

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_705882_c1|nmdc:mga09592_705882_c1_296_787
Length 163
Sequence LSDTGVLLAKLQADLKEFIELLNSHSVEYLIVGGHAVAFHGHPRFTGDIDFFIRVTPSNVQRLLAVLDDFGFGSLGITERDLLEPKRIVQLGQPPNRIDILTSISGVDFESAWESRIESSMDGQPIMMIGWNELLRNKKAAGRQKDLADIDKLLAIAKRKGSG

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
105 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
106 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
114 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
117 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.23
Rhizosphere 98.15
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_3597510 2162886011 Bacteria 1094
2 MBSR1b_contig_545540 2162886012 Bacteria 1005
3 CNAas_1000220 3300000532 Bacteria 5338
4 JGI24035J26624_1002954 3300002126 Unclassified 1590
5 JGI25406J46586_10007576 3300003203 Unclassified 4945
6 JGI25405J52794_10002725 3300003911 Bacteria 3069
7 Ga0065714_10064422 3300005288 Bacteria 270668
8 Ga0065712_10000122 3300005290 Bacteria 92508
9 Ga0065712_10471753 3300005290 Unclassified 670
10 Ga0065715_10089124 3300005293 Bacteria 13934
11 Ga0065707_10347409 3300005295 Unclassified 924
12 Ga0065707_11066605 3300005295 Unclassified 523
13 Ga0070676_10000532 3300005328 Bacteria 18338
14 Ga0068869_100037030 3300005334 Bacteria 3467
15 Ga0068869_101010402 3300005334 Unclassified 724
16 Ga0068869_101371182 3300005334 Unclassified 625
17 Ga0068868_100033756 3300005338 Bacteria 3946
18 Ga0070689_100273518 3300005340 Unclassified 1399
19 Ga0070687_100034519 3300005343 Bacteria 2504
20 Ga0070668_100011711 3300005347 Bacteria 6531
21 Ga0070669_100087902 3300005353 Bacteria 2325
22 Ga0070675_100063071 3300005354 Bacteria 3063
23 Ga0070671_100240181 3300005355 Bacteria 1538
24 Ga0070674_100083299 3300005356 Bacteria 2290
25 Ga0070705_100006187 3300005440 Bacteria 5861
26 Ga0070694_100025858 3300005444 Bacteria 3801
27 Ga0070708_100079469 3300005445 Unclassified 2967
28 Ga0070708_100227352 3300005445 Bacteria 1751
29 Ga0070708_100392367 3300005445 Bacteria 1309
30 Ga0070662_100014839 3300005457 Bacteria 5209
31 Ga0068867_100967843 3300005459 Unclassified 770
32 Ga0070706_100135977 3300005467 Bacteria 2294
33 Ga0070706_100204897 3300005467 Bacteria 1842
34 Ga0070706_100270394 3300005467 Bacteria 1586
35 Ga0070706_100918374 3300005467 Bacteria 808
36 Ga0070706_101378628 3300005467 Bacteria 646
37 Ga0070707_100459219 3300005468 Bacteria 1234
38 Ga0070707_100689087 3300005468 Unclassified 984
39 Ga0070698_100626500 3300005471 Bacteria 1016
40 Ga0070699_100327402 3300005518 Viruses 1378
41 Ga0070699_100554062 3300005518 Unclassified 1047
42 Ga0070679_101146969 3300005530 Unclassified 722
43 Ga0070697_100120543 3300005536 Bacteria 2194
44 Ga0070697_100332213 3300005536 Bacteria 1310
45 Ga0070697_100548192 3300005536 Bacteria 1014
46 Ga0070697_101878381 3300005536 Unclassified 536
47 Ga0068853_100002172 3300005539 Bacteria 14610
48 Ga0068853_100537717 3300005539 Bacteria 1106
49 Ga0070672_101348507 3300005543 Unclassified 637
50 Ga0070693_100931055 3300005547 Unclassified 653
51 Ga0070704_100078579 3300005549 Unclassified 2421
52 Ga0070704_100130316 3300005549 Bacteria 1948
53 Ga0068857_100012428 3300005577 Bacteria 7411
54 Ga0068856_100788860 3300005614 Bacteria 970
55 Ga0068852_100565095 3300005616 Unclassified 1139
56 Ga0068859_100746710 3300005617 Bacteria 1067
57 Ga0068859_101146075 3300005617 Unclassified 856
58 Ga0068858_100767466 3300005842 Bacteria 940
59 Ga0068860_100017168 3300005843 Bacteria 7055
60 Ga0068862_100023055 3300005844 Bacteria 5214
61 Ga0081455_10000781 3300005937 Bacteria 40919
62 Ga0081539_10017690 3300005985 Bacteria 4989
63 Ga0070717_10096313 3300006028 Bacteria 2506
64 Ga0097621_100382738 3300006237 Bacteria 1257
65 Ga0068871_100615474 3300006358 Bacteria 989
66 Ga0075433_10104376 3300006852 Bacteria 2511
67 Ga0075433_10768958 3300006852 Bacteria 842
68 Ga0075434_101586091 3300006871 Unclassified 663
69 Ga0068865_100775328 3300006881 Unclassified 825
70 Ga0075436_100285153 3300006914 Unclassified 1181
71 Ga0097620_100746714 3300006931 Bacteria 1067
72 Ga0097620_101146008 3300006931 Unclassified 856
73 Ga0105240_10014139 3300009093 Bacteria 10904
74 Ga0105240_10128366 3300009093 Bacteria 3044
75 Ga0105245_10040267 3300009098 Bacteria 4162
76 Ga0114129_10784873 3300009147 Bacteria 1217
77 Ga0114129_11829307 3300009147 Unclassified 738
78 Ga0105243_10218697 3300009148 Unclassified 1682
79 Ga0105241_11132887 3300009174 Unclassified 738
80 Ga0105241_11342342 3300009174 Unclassified 682
81 Ga0105237_11853299 3300009545 Unclassified 611
82 Ga0105237_11995791 3300009545 Unclassified 589
83 Ga0105238_11342255 3300009551 Unclassified 742
84 Ga0105249_10021031 3300009553 Bacteria 5840
85 Ga0105249_11988190 3300009553 Unclassified 654
86 Ga0105239_10014044 3300010375 Bacteria 8890
87 Ga0105239_10398568 3300010375 Bacteria 1557
88 Ga0105239_12895507 3300010375 Bacteria 560
89 Ga0105246_10311578 3300011119 Bacteria 1275
90 Ga0157373_10716301 3300013100 Unclassified 734
91 Ga0157371_10399168 3300013102 Unclassified 1006
92 Ga0157374_10053569 3300013296 Bacteria 3761
93 Ga0157378_10039247 3300013297 Bacteria 4199
94 Ga0157378_10664510 3300013297 Bacteria 1059
95 Ga0163162_10019843 3300013306 Bacteria 6600
96 Ga0157372_10008406 3300013307 Bacteria 10963
97 Ga0157372_10199950 3300013307 Bacteria 2315
98 Ga0157372_10319012 3300013307 Bacteria 1809
99 Ga0163161_10206996 3300017792 Unclassified 1514
100 Ga0207673_1010273 3300025290 Unclassified 1203
101 Ga0207697_10000802 3300025315 Bacteria 17850
102 Ga0207647_10033599 3300025904 Bacteria 3284
103 Ga0207645_10003147 3300025907 Bacteria 12643
104 Ga0207684_10111351 3300025910 Bacteria 2343
105 Ga0207684_10158813 3300025910 Bacteria 1946
106 Ga0207684_10360704 3300025910 Bacteria 1251
107 Ga0207684_11320493 3300025910 Bacteria 593
108 Ga0207695_10074289 3300025913 Unclassified 3461
109 Ga0207695_10119879 3300025913 Bacteria 2600
110 Ga0207671_10734600 3300025914 Unclassified 784
111 Ga0207657_10282838 3300025919 Unclassified 1316
112 Ga0207646_10000886 3300025922 Bacteria 38660
113 Ga0207646_10001911 3300025922 Bacteria 25095
114 Ga0207681_10001128 3300025923 Bacteria 17315
115 Ga0207650_10179645 3300025925 Bacteria 1686
116 Ga0207659_10152449 3300025926 Bacteria 1806
117 Ga0207687_10053160 3300025927 Bacteria 2828
118 Ga0207644_10476628 3300025931 Bacteria 1027
119 Ga0207690_11172164 3300025932 Unclassified 641
120 Ga0207706_10015823 3300025933 Bacteria 6820
121 Ga0207709_10521927 3300025935 Unclassified 930
122 Ga0207670_10317267 3300025936 Unclassified 1225
123 Ga0207669_10453026 3300025937 Unclassified 1017
124 Ga0207689_10941658 3300025942 Unclassified 729
125 Ga0207689_11238487 3300025942 Unclassified 628
126 Ga0207679_11616648 3300025945 Unclassified 594
127 Ga0207667_10569851 3300025949 Bacteria 1144
128 Ga0207712_10043479 3300025961 Bacteria 3100
129 Ga0207712_10416183 3300025961 Bacteria 1133
130 Ga0207668_10017030 3300025972 Bacteria 4547
131 Ga0207668_10369825 3300025972 Bacteria 1204
132 Ga0207658_10212685 3300025986 Bacteria 1621
133 Ga0207677_10007393 3300026023 Bacteria 6073
134 Ga0207639_10000045 3300026041 Bacteria 136152
135 Ga0207702_10623090 3300026078 Bacteria 1060
136 Ga0207674_10038870 3300026116 Bacteria 4936
137 Ga0207675_100848933 3300026118 Unclassified 928
138 Ga0207698_10503886 3300026142 Unclassified 1179
139 Ga0268265_10043487 3300028380 Bacteria 3340
140 Ga0268264_10981502 3300028381 Bacteria 851
141 Ga0265338_10263861 3300028800 Unclassified 1265
142 Ga0316178_1075261 3300030735 Bacteria 1048
143 Ga0316577_10029311 3300031733 Bacteria 3072
144 Ga0373929_0000006 3300035085 Bacteria 324796
145 Ga0373943_0375099 3300035170 Bacteria 818
146 Ga0395898_0841662 3300037466 Unclassified 857
147 Ga0242422_03034 3300038699 Bacteria 1109
148 Ga0436365_1227033 3300039437 Bacteria 639
149 Ga0451791_1306898 3300041451 Bacteria 1414
150 Ga0451576_0157759 3300045051 Bacteria 2367
151 Ga0495659_0342902 3300046664 Bacteria 637
152 Ga0495636_0113821 3300047318 Bacteria 1192
153 Ga0496112_0288921 3300048915 Bacteria 1586
154 Ga0501292_042940 3300049515 Bacteria 785
155 Ga0501294_015911 3300049517 Unclassified 780
156 Ga0501033_0310763 3300049570 Unclassified 1108
157 Ga0501034_0000173 3300049571 Bacteria 120344
158 Ga0501038_0028275 3300049574 Bacteria 4981
159 Ga0501225_0016402 3300049705 Bacteria 2060
160 nmdc:mga05p37_978460_c1 3300050507 Unclassified 902
161 nmdc:mga09592_705882_c1 3300050508 Unclassified 858
162 nmdc:mga08x19_113432_c1 3300050514 Bacteria 1810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100918374 Ga0070706_1009183741 118
2 3300005338 Ga0068868_100033756 Ga0068868_1000337563 126
3 3300005343 Ga0070687_100034519 Ga0070687_1000345194 126
4 3300005459 Ga0068867_100967843 Ga0068867_1009678431 126
5 3300025910 Ga0207684_11320493 Ga0207684_113204932 140
6 3300005536 Ga0070697_101878381 Ga0070697_1018783811 143
7 3300035170 Ga0373943_0375099 Ga0373943_0375099_342_797 143
8 3300049570 Ga0501033_0310763 Ga0501033_0310763_361_807 143
9 3300049574 Ga0501038_0028275 Ga0501038_0028275_1555_2001 143
10 2162886011 MRS1b_contig_3597510 MRS1b_0351.00002730 145
11 2162886012 MBSR1b_contig_545540 MBSR1b_0492.00002660 145
12 3300000532 CNAas_1000220 CNAas_10002202 145
13 3300002126 JGI24035J26624_1002954 JGI24035J26624_10029542 145
14 3300003203 JGI25406J46586_10007576 JGI25406J46586_100075764 145
15 3300003911 JGI25405J52794_10002725 JGI25405J52794_100027254 145
16 3300005288 Ga0065714_10064422 Ga0065714_10064422243 145
17 3300005290 Ga0065712_10000122 Ga0065712_1000012280 145
18 3300005290 Ga0065712_10471753 Ga0065712_104717531 145
19 3300005293 Ga0065715_10089124 Ga0065715_100891246 145
20 3300005295 Ga0065707_10347409 Ga0065707_103474092 145
21 3300005295 Ga0065707_11066605 Ga0065707_110666051 145
22 3300005328 Ga0070676_10000532 Ga0070676_100005327 145
23 3300005334 Ga0068869_100037030 Ga0068869_1000370303 145
24 3300005334 Ga0068869_101010402 Ga0068869_1010104022 145
25 3300005334 Ga0068869_101371182 Ga0068869_1013711821 145
26 3300005340 Ga0070689_100273518 Ga0070689_1002735182 145
27 3300005347 Ga0070668_100011711 Ga0070668_1000117114 145
28 3300005353 Ga0070669_100087902 Ga0070669_1000879023 145
29 3300005354 Ga0070675_100063071 Ga0070675_1000630714 145
30 3300005355 Ga0070671_100240181 Ga0070671_1002401813 145
31 3300005356 Ga0070674_100083299 Ga0070674_1000832993 145
32 3300005440 Ga0070705_100006187 Ga0070705_1000061873 145
33 3300005444 Ga0070694_100025858 Ga0070694_1000258584 145
34 3300005445 Ga0070708_100079469 Ga0070708_1000794693 145
35 3300005445 Ga0070708_100227352 Ga0070708_1002273522 145
36 3300005445 Ga0070708_100392367 Ga0070708_1003923672 145
37 3300005457 Ga0070662_100014839 Ga0070662_1000148396 145
38 3300005467 Ga0070706_100135977 Ga0070706_1001359772 145
39 3300005467 Ga0070706_100204897 Ga0070706_1002048973 145
40 3300005467 Ga0070706_100270394 Ga0070706_1002703941 145
41 3300005467 Ga0070706_101378628 Ga0070706_1013786281 145
42 3300005468 Ga0070707_100459219 Ga0070707_1004592192 145
43 3300005468 Ga0070707_100689087 Ga0070707_1006890872 145
44 3300005471 Ga0070698_100626500 Ga0070698_1006265002 145
45 3300005518 Ga0070699_100327402 Ga0070699_1003274021 145
46 3300005518 Ga0070699_100554062 Ga0070699_1005540622 145
47 3300005530 Ga0070679_101146969 Ga0070679_1011469691 145
48 3300005536 Ga0070697_100120543 Ga0070697_1001205432 145
49 3300005536 Ga0070697_100332213 Ga0070697_1003322132 145
50 3300005536 Ga0070697_100548192 Ga0070697_1005481923 145
51 3300005539 Ga0068853_100002172 Ga0068853_1000021727 145
52 3300005539 Ga0068853_100537717 Ga0068853_1005377173 145
53 3300005543 Ga0070672_101348507 Ga0070672_1013485071 145
54 3300005547 Ga0070693_100931055 Ga0070693_1009310552 145
55 3300005549 Ga0070704_100078579 Ga0070704_1000785792 145
56 3300005549 Ga0070704_100130316 Ga0070704_1001303162 145
57 3300005577 Ga0068857_100012428 Ga0068857_1000124283 145
58 3300005614 Ga0068856_100788860 Ga0068856_1007888603 145
59 3300005616 Ga0068852_100565095 Ga0068852_1005650951 145
60 3300005617 Ga0068859_100746710 Ga0068859_1007467102 145
61 3300005617 Ga0068859_101146075 Ga0068859_1011460752 145
62 3300005842 Ga0068858_100767466 Ga0068858_1007674662 145
63 3300005843 Ga0068860_100017168 Ga0068860_1000171683 145
64 3300005844 Ga0068862_100023055 Ga0068862_1000230555 145
65 3300005937 Ga0081455_10000781 Ga0081455_1000078142 145
66 3300005985 Ga0081539_10017690 Ga0081539_100176904 145
67 3300006028 Ga0070717_10096313 Ga0070717_100963132 145
68 3300006237 Ga0097621_100382738 Ga0097621_1003827382 145
69 3300006358 Ga0068871_100615474 Ga0068871_1006154743 145
70 3300006852 Ga0075433_10104376 Ga0075433_101043765 145
71 3300006852 Ga0075433_10768958 Ga0075433_107689582 145
72 3300006871 Ga0075434_101586091 Ga0075434_1015860912 145
73 3300006881 Ga0068865_100775328 Ga0068865_1007753281 145
74 3300006914 Ga0075436_100285153 Ga0075436_1002851532 145
75 3300006931 Ga0097620_100746714 Ga0097620_1007467142 145
76 3300006931 Ga0097620_101146008 Ga0097620_1011460082 145
77 3300009093 Ga0105240_10014139 Ga0105240_100141399 145
78 3300009093 Ga0105240_10128366 Ga0105240_101283662 145
79 3300009098 Ga0105245_10040267 Ga0105245_100402675 145
80 3300009147 Ga0114129_10784873 Ga0114129_107848732 145
81 3300009147 Ga0114129_11829307 Ga0114129_118293071 145
82 3300009148 Ga0105243_10218697 Ga0105243_102186972 145
83 3300009174 Ga0105241_11132887 Ga0105241_111328872 145
84 3300009174 Ga0105241_11342342 Ga0105241_113423421 145
85 3300009545 Ga0105237_11853299 Ga0105237_118532991 145
86 3300009545 Ga0105237_11995791 Ga0105237_119957912 145
87 3300009551 Ga0105238_11342255 Ga0105238_113422551 145
88 3300009553 Ga0105249_10021031 Ga0105249_100210317 145
89 3300009553 Ga0105249_11988190 Ga0105249_119881901 145
90 3300010375 Ga0105239_10014044 Ga0105239_100140445 145
91 3300010375 Ga0105239_10398568 Ga0105239_103985683 145
92 3300010375 Ga0105239_12895507 Ga0105239_128955071 145
93 3300011119 Ga0105246_10311578 Ga0105246_103115782 145
94 3300013100 Ga0157373_10716301 Ga0157373_107163012 145
95 3300013102 Ga0157371_10399168 Ga0157371_103991682 145
96 3300013296 Ga0157374_10053569 Ga0157374_100535692 145
97 3300013297 Ga0157378_10039247 Ga0157378_100392474 145
98 3300013297 Ga0157378_10664510 Ga0157378_106645102 145
99 3300013306 Ga0163162_10019843 Ga0163162_100198432 145
100 3300013307 Ga0157372_10008406 Ga0157372_100084062 145
101 3300013307 Ga0157372_10199950 Ga0157372_101999501 145
102 3300013307 Ga0157372_10319012 Ga0157372_103190121 145
103 3300017792 Ga0163161_10206996 Ga0163161_102069962 145
104 3300025290 Ga0207673_1010273 Ga0207673_10102731 145
105 3300025315 Ga0207697_10000802 Ga0207697_1000080214 145
106 3300025904 Ga0207647_10033599 Ga0207647_100335993 145
107 3300025907 Ga0207645_10003147 Ga0207645_1000314712 145
108 3300025910 Ga0207684_10111351 Ga0207684_101113512 145
109 3300025910 Ga0207684_10158813 Ga0207684_101588132 145
110 3300025910 Ga0207684_10360704 Ga0207684_103607041 145
111 3300025913 Ga0207695_10074289 Ga0207695_100742895 145
112 3300025913 Ga0207695_10119879 Ga0207695_101198792 145
113 3300025914 Ga0207671_10734600 Ga0207671_107346001 145
114 3300025919 Ga0207657_10282838 Ga0207657_102828382 145
115 3300025922 Ga0207646_10000886 Ga0207646_1000088611 145
116 3300025922 Ga0207646_10001911 Ga0207646_1000191125 145
117 3300025923 Ga0207681_10001128 Ga0207681_100011287 145
118 3300025925 Ga0207650_10179645 Ga0207650_101796453 145
119 3300025926 Ga0207659_10152449 Ga0207659_101524491 145
120 3300025927 Ga0207687_10053160 Ga0207687_100531603 145
121 3300025931 Ga0207644_10476628 Ga0207644_104766282 145
122 3300025932 Ga0207690_11172164 Ga0207690_111721641 145
123 3300025933 Ga0207706_10015823 Ga0207706_100158233 145
124 3300025935 Ga0207709_10521927 Ga0207709_105219272 145
125 3300025936 Ga0207670_10317267 Ga0207670_103172672 145
126 3300025937 Ga0207669_10453026 Ga0207669_104530262 145
127 3300025942 Ga0207689_10941658 Ga0207689_109416582 145
128 3300025942 Ga0207689_11238487 Ga0207689_112384872 145
129 3300025945 Ga0207679_11616648 Ga0207679_116166481 145
130 3300025949 Ga0207667_10569851 Ga0207667_105698513 145
131 3300025961 Ga0207712_10043479 Ga0207712_100434793 145
132 3300025961 Ga0207712_10416183 Ga0207712_104161831 145
133 3300025972 Ga0207668_10017030 Ga0207668_100170303 145
134 3300025972 Ga0207668_10369825 Ga0207668_103698252 145
135 3300025986 Ga0207658_10212685 Ga0207658_102126853 145
136 3300026023 Ga0207677_10007393 Ga0207677_100073935 145
137 3300026041 Ga0207639_10000045 Ga0207639_1000004556 145
138 3300026078 Ga0207702_10623090 Ga0207702_106230902 145
139 3300026116 Ga0207674_10038870 Ga0207674_100388705 145
140 3300026118 Ga0207675_100848933 Ga0207675_1008489332 145
141 3300026142 Ga0207698_10503886 Ga0207698_105038861 145
142 3300028380 Ga0268265_10043487 Ga0268265_100434873 145
143 3300028381 Ga0268264_10981502 Ga0268264_109815022 145
144 3300028800 Ga0265338_10263861 Ga0265338_102638612 145
145 3300030735 Ga0316178_1075261 Ga0316178_10752612 145
146 3300031733 Ga0316577_10029311 Ga0316577_100293111 145
147 3300035085 Ga0373929_0000006 Ga0373929_0000006_46651_47121 145
148 3300037466 Ga0395898_0841662 Ga0395898_0841662_147_590 145
149 3300038699 Ga0242422_03034 Ga0242422_03034_354_794 145
150 3300039437 Ga0436365_1227033 Ga0436365_1227033_132_575 145
151 3300041451 Ga0451791_1306898 Ga0451791_1306898_341_799 145
152 3300045051 Ga0451576_0157759 Ga0451576_0157759_183_626 145
153 3300046664 Ga0495659_0342902 Ga0495659_0342902_132_590 145
154 3300047318 Ga0495636_0113821 Ga0495636_0113821_508_966 145
155 3300048915 Ga0496112_0288921 Ga0496112_0288921_968_1414 145
156 3300049515 Ga0501292_042940 Ga0501292_042940_122_562 145
157 3300049517 Ga0501294_015911 Ga0501294_015911_317_757 145
158 3300049571 Ga0501034_0000173 Ga0501034_0000173_31213_31677 145
159 3300049705 Ga0501225_0016402 Ga0501225_0016402_1139_1579 145
160 3300050507 nmdc:mga05p37_978460_c1 nmdc:mga05p37_978460_c1_127_567 145
161 3300050508 nmdc:mga09592_705882_c1 nmdc:mga09592_705882_c1_296_787 145
162 3300050514 nmdc:mga08x19_113432_c1 nmdc:mga08x19_113432_c1_487_954 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19502

DUF6036

Nucleotidyltransferase of unknown function (DUF6036)

8

158

0.9

PF09970

DUF2204

Nucleotidyl transferase of unknown function (DUF2204)

11

162

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3asd-assembly1.cif.gz_A mama r50e mutant 0.6719 47 75
4alz-assembly1.cif.gz_A the yersinia t3ss basal body component yscd reveals a different structural periplasmatic domain organization to known homologue prgh 0.6656 4 66
8far-assembly1.cif.gz_A accurate computational design of genetically encoded 3d protein crystals 0.6567 47 76
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.6514 47 76
8an5-assembly1.cif.gz_B menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv 0.6185 7 144
ID Description Score Start End Superfamily
af_I1JYR8_265_335_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7032 48 75 1.25.40.10
af_A0A1D8PN34_310_470_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6954 45 74 1.25.40.10
af_A0A1D6NL00_310_396_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6908 48 73 1.25.40.10
af_K7N244_719_850_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6847 45 75 1.25.40.10
af_O23052_227_305_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6839 47 75 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A0R2Q6K6-F1-model_v4 LytR/CpsA/Psr regulator C-terminal domain-containing protein 0.9368 46 143
AF-A0A1V5E9G7-F1-model_v4 Uncharacterized protein 0.9342 45 143
AF-A0A1F9A6E6-F1-model_v4 Uncharacterized protein 0.9241 40 145
AF-A0A850BFV4-F1-model_v4 Nucleotidyltransferase 0.9193 4 129 GO:0016740
AF-A0A2W0B7X7-F1-model_v4 Nucleotidyltransferase family protein 0.9153 40 143

Feature Viewer

pLDDT pTM Quality
86.63 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map