F239571

General Info

Members Datasets Scaffolds Average Seq Length
162 111 324 173

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10002335|Ga0265338_1000233518
Length 204
Sequence MLAICRAVTTEFYTLDICPSEFKIRAMVLPYKVATLLYCFNERDDVLLLERAQEPNRGFWSPCGGKLKMDIGESPYVCACREAEEELGIKVRTVDLHLTGLVSEHGYQGQTHWLMFLFEIKVRLKTLPPVHAEGRFQFFTRETLASLKIPQTDREQIWPWFWQHRGGFFAAHCHCHPDGHNEWTREESIINSKSEIPSHGRTDH

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
46 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
47 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
48 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
49 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
50 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
51 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
52 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
54 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
55 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
56 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
57 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
63 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
64 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
65 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
66 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
67 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
68 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
69 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
83 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
84 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
87 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
105 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
106 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
110 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
111 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.38
Stem 0
Stem Tuber 0
Unclassified 23.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10002335 3300028800 Bacteria 28668
2 CNXas_1000690 3300000545 Unclassified 2195
3 rootH2_10238696 3300003320 Unclassified 1111
4 Ga0070658_10110741 3300005327 Unclassified 2274
5 Ga0070683_100349725 3300005329 Unclassified 1408
6 Ga0070690_100273224 3300005330 Unclassified 1203
7 Ga0068869_100457281 3300005334 Bacteria 1059
8 Ga0070680_100434795 3300005336 Bacteria 1120
9 Ga0070689_100004436 3300005340 Bacteria 9480
10 Ga0070689_100183389 3300005340 Bacteria 1701
11 Ga0070689_100797581 3300005340 Bacteria 830
12 Ga0070713_100321653 3300005436 Bacteria 1429
13 Ga0070711_100033531 3300005439 Bacteria 3419
14 Ga0070681_10031589 3300005458 Bacteria 5315
15 Ga0068855_100086119 3300005563 Bacteria 3634
16 Ga0068855_100677955 3300005563 Unclassified 1105
17 Ga0068855_100905414 3300005563 Bacteria 932
18 Ga0068857_100003587 3300005577 Bacteria 12987
19 Ga0068856_100007178 3300005614 Bacteria 10864
20 Ga0068856_100264899 3300005614 Bacteria 1734
21 Ga0068856_100388062 3300005614 Bacteria 1416
22 Ga0068859_100321204 3300005617 Unclassified 1642
23 Ga0068859_100428207 3300005617 Bacteria 1420
24 Ga0068859_101694689 3300005617 Bacteria 698
25 Ga0068861_101194948 3300005719 Bacteria 735
26 Ga0068863_100077990 3300005841 Bacteria 3136
27 Ga0070715_10171064 3300006163 Bacteria 1082
28 Ga0097621_100240827 3300006237 Bacteria 1581
29 Ga0075434_100884369 3300006871 Bacteria 908
30 Ga0068865_100204557 3300006881 Bacteria 1535
31 Ga0097620_100321204 3300006931 Unclassified 1642
32 Ga0097620_101694179 3300006931 Bacteria 698
33 Ga0075435_100365466 3300007076 Bacteria 1238
34 Ga0105240_10068655 3300009093 Bacteria 4390
35 Ga0105245_10299212 3300009098 Bacteria 1578
36 Ga0105238_10031796 3300009551 Bacteria 5370
37 Ga0105238_10101419 3300009551 Bacteria 2861
38 Ga0105249_11848171 3300009553 Unclassified 677
39 Ga0157378_10371069 3300013297 Unclassified 1403
40 Ga0157375_10000080 3300013308 Bacteria 96665
41 Ga0163163_10000153 3300014325 Bacteria 71877
42 Ga0207685_10149360 3300025905 Bacteria 1056
43 Ga0207705_10131119 3300025909 Bacteria 1866
44 Ga0207695_10054239 3300025913 Unclassified 4188
45 Ga0207695_10276935 3300025913 Unclassified 1572
46 Ga0207663_10175225 3300025916 Bacteria 1527
47 Ga0207694_10022732 3300025924 Bacteria 4756
48 Ga0207687_10193539 3300025927 Bacteria 1584
49 Ga0207670_10205873 3300025936 Bacteria 1497
50 Ga0207670_10368999 3300025936 Unclassified 1140
51 Ga0207670_10698356 3300025936 Bacteria 840
52 Ga0207704_10138075 3300025938 Bacteria 1700
53 Ga0207667_10109525 3300025949 Bacteria 2848
54 Ga0207677_10071216 3300026023 Bacteria 2453
55 Ga0207641_10083119 3300026088 Bacteria 2784
56 Ga0207674_10024113 3300026116 Bacteria 6506
57 Ga0207675_100927580 3300026118 Bacteria 887
58 Ga0265337_1002536 3300028556 Bacteria 8321
59 Ga0265337_1022739 3300028556 Bacteria 1937
60 Ga0265326_10026486 3300028558 Bacteria 1653
61 Ga0265319_1000003 3300028563 Bacteria 340561
62 Ga0265319_1005501 3300028563 Bacteria 6059
63 Ga0265319_1026422 3300028563 Unclassified 2069
64 Ga0265318_10031598 3300028577 Bacteria 2053
65 Ga0265318_10117256 3300028577 Unclassified 978
66 Ga0265323_10014078 3300028653 Bacteria 3177
67 Ga0265323_10015978 3300028653 Bacteria 2939
68 Ga0265336_10002126 3300028666 Bacteria 8385
69 Ga0265336_10023466 3300028666 Bacteria 1955
70 Ga0265336_10049279 3300028666 Unclassified 1276
71 Ga0265338_10000050 3300028800 Bacteria 213659
72 Ga0265338_10000088 3300028800 Bacteria 174641
73 Ga0265338_10002667 3300028800 Bacteria 26222
74 Ga0265338_10005089 3300028800 Bacteria 17354
75 Ga0265338_10005734 3300028800 Bacteria 16058
76 Ga0265338_10008490 3300028800 Bacteria 12461
77 Ga0265338_10031397 3300028800 Bacteria 5210
78 Ga0265338_10049566 3300028800 Bacteria 3805
79 Ga0265338_10065921 3300028800 Bacteria 3137
80 Ga0265338_10292651 3300028800 Unclassified 1186
81 Ga0265338_10353188 3300028800 Bacteria 1056
82 Ga0265324_10004641 3300029957 Bacteria 6128
83 Ga0265324_10164832 3300029957 Unclassified 753
84 Ga0265760_10213487 3300031090 Bacteria 656
85 Ga0265332_10098094 3300031238 Bacteria 1237
86 Ga0265320_10000590 3300031240 Bacteria 27907
87 Ga0265320_10006935 3300031240 Bacteria 7071
88 Ga0265320_10025098 3300031240 Bacteria 3140
89 Ga0265325_10107715 3300031241 Bacteria 1357
90 Ga0265325_10126195 3300031241 Unclassified 1229
91 Ga0265340_10161888 3300031247 Bacteria 1017
92 Ga0265339_10004033 3300031249 Bacteria 10143
93 Ga0265327_10009286 3300031251 Bacteria 7124
94 Ga0265316_10008681 3300031344 Bacteria 9405
95 Ga0265316_10043701 3300031344 Bacteria 3568
96 Ga0265313_10000993 3300031595 Bacteria 27845
97 Ga0265313_10001677 3300031595 Bacteria 20480
98 Ga0265314_10011969 3300031711 Bacteria 7114
99 Ga0265342_10018152 3300031712 Bacteria 4563
100 Ga0265342_10041421 3300031712 Bacteria 2789
101 Ga0316578_10085347 3300031728 Bacteria 1882
102 Ga0373934_0103809 3300035086 Bacteria 1150
103 Ga0373941_0128770 3300035115 Bacteria 910
104 Ga0373954_0051163 3300035118 Bacteria 1939
105 Ga0373956_0022524 3300035119 Unclassified 2697
106 Ga0373946_0148270 3300035171 Bacteria 1093
107 Ga0373942_0086292 3300035207 Bacteria 939
108 Ga0373933_0006504 3300035724 Bacteria 6362
109 Ga0373947_0295069 3300035725 Bacteria 1080
110 Ga0373947_0504913 3300035725 Unclassified 822
111 Ga0373937_0032996 3300036401 Bacteria 4698
112 Ga0373937_0112624 3300036401 Unclassified 2531
113 Ga0316584_0206387 3300036712 Bacteria 1448
114 Ga0373925_0754560 3300037068 Unclassified 802
115 Ga0316581_0208194 3300037588 Unclassified 602
116 Ga0453684_0346479 3300044712 Bacteria 1676
117 Ga0451576_0046022 3300045051 Bacteria 4595
118 Ga0451576_0088608 3300045051 Bacteria 3219
119 Ga0451576_0096189 3300045051 Bacteria 3080
120 Ga0451576_0228661 3300045051 Bacteria 1942
121 Ga0451576_1367735 3300045051 Unclassified 737
122 Ga0495653_0388845 3300046463 Unclassified 889
123 Ga0495618_0004601 3300046514 Bacteria 8448
124 Ga0495628_0074422 3300046516 Bacteria 2646
125 Ga0495628_0881675 3300046516 Unclassified 622
126 Ga0495630_0262075 3300046517 Unclassified 1320
127 Ga0495630_0484608 3300046517 Unclassified 948
128 Ga0495652_0372406 3300046529 Unclassified 1018
129 Ga0495652_0418841 3300046529 Unclassified 944
130 Ga0495640_0079243 3300046533 Bacteria 2187
131 Ga0495586_0000893 3300046535 Bacteria 17020
132 Ga0495586_0142047 3300046535 Bacteria 1348
133 Ga0495587_0221479 3300046536 Unclassified 1067
134 Ga0495598_0115977 3300046537 Bacteria 903
135 Ga0495667_0395562 3300046559 Bacteria 871
136 Ga0495634_0003623 3300046642 Bacteria 12338
137 Ga0495599_0008045 3300046678 Bacteria 6400
138 Ga0495599_0076971 3300046678 Bacteria 2083
139 Ga0495658_0070427 3300046683 Unclassified 2029
140 Ga0495669_0114022 3300046684 Bacteria 1264
141 Ga0495613_0023357 3300046689 Bacteria 4606
142 Ga0495613_0094046 3300046689 Unclassified 2169
143 Ga0495674_0395128 3300047319 Bacteria 1117
144 Ga0495680_0007926 3300047322 Bacteria 9687
145 Ga0495677_0144501 3300047445 Bacteria 914
146 Ga0495684_0391962 3300047471 Unclassified 977
147 Ga0495602_0216749 3300048088 Unclassified 1448
148 Ga0501031_0000043 3300049568 Bacteria 67296
149 Ga0501032_0011143 3300049569 Bacteria 6462
150 Ga0501033_0010249 3300049570 Bacteria 7191
151 Ga0501039_0185697 3300049575 Bacteria 1635
152 Ga0501043_0313023 3300049579 Bacteria 1198
153 Ga0501046_0240525 3300049580 Bacteria 1335
154 Ga0501217_014205 3300049661 Bacteria 1795
155 Ga0501257_025642 3300049686 Bacteria 1403
156 Ga0501232_046825 3300049757 Bacteria 655
157 Ga0501035_0001482 3300049822 Bacteria 24029
158 Ga0501044_0000032 3300049823 Bacteria 169439
159 Ga0501044_0109053 3300049823 Bacteria 2778
160 nmdc:mga08y16_1004473_c1 3300050511 Unclassified 814
161 nmdc:mga0rr50_335109_c1 3300050513 Bacteria 1270
162 nmdc:mga08x19_348266_c1 3300050514 Unclassified 1034
163 Ga0265338_10002335
164 CNXas_1000690
165 rootH2_10238696
166 Ga0070658_10110741
167 Ga0070683_100349725
168 Ga0070690_100273224
169 Ga0068869_100457281
170 Ga0070680_100434795
171 Ga0070689_100004436
172 Ga0070689_100183389
173 Ga0070689_100797581
174 Ga0070713_100321653
175 Ga0070711_100033531
176 Ga0070681_10031589
177 Ga0068855_100086119
178 Ga0068855_100677955
179 Ga0068855_100905414
180 Ga0068857_100003587
181 Ga0068856_100007178
182 Ga0068856_100264899
183 Ga0068856_100388062
184 Ga0068859_100321204
185 Ga0068859_100428207
186 Ga0068859_101694689
187 Ga0068861_101194948
188 Ga0068863_100077990
189 Ga0070715_10171064
190 Ga0097621_100240827
191 Ga0075434_100884369
192 Ga0068865_100204557
193 Ga0097620_100321204
194 Ga0097620_101694179
195 Ga0075435_100365466
196 Ga0105240_10068655
197 Ga0105245_10299212
198 Ga0105238_10031796
199 Ga0105238_10101419
200 Ga0105249_11848171
201 Ga0157378_10371069
202 Ga0157375_10000080
203 Ga0163163_10000153
204 Ga0207685_10149360
205 Ga0207705_10131119
206 Ga0207695_10054239
207 Ga0207695_10276935
208 Ga0207663_10175225
209 Ga0207694_10022732
210 Ga0207687_10193539
211 Ga0207670_10205873
212 Ga0207670_10368999
213 Ga0207670_10698356
214 Ga0207704_10138075
215 Ga0207667_10109525
216 Ga0207677_10071216
217 Ga0207641_10083119
218 Ga0207674_10024113
219 Ga0207675_100927580
220 Ga0265337_1002536
221 Ga0265337_1022739
222 Ga0265326_10026486
223 Ga0265319_1000003
224 Ga0265319_1005501
225 Ga0265319_1026422
226 Ga0265318_10031598
227 Ga0265318_10117256
228 Ga0265323_10014078
229 Ga0265323_10015978
230 Ga0265336_10002126
231 Ga0265336_10023466
232 Ga0265336_10049279
233 Ga0265338_10000050
234 Ga0265338_10000088
235 Ga0265338_10002667
236 Ga0265338_10005089
237 Ga0265338_10005734
238 Ga0265338_10008490
239 Ga0265338_10031397
240 Ga0265338_10049566
241 Ga0265338_10065921
242 Ga0265338_10292651
243 Ga0265338_10353188
244 Ga0265324_10004641
245 Ga0265324_10164832
246 Ga0265760_10213487
247 Ga0265332_10098094
248 Ga0265320_10000590
249 Ga0265320_10006935
250 Ga0265320_10025098
251 Ga0265325_10107715
252 Ga0265325_10126195
253 Ga0265340_10161888
254 Ga0265339_10004033
255 Ga0265327_10009286
256 Ga0265316_10008681
257 Ga0265316_10043701
258 Ga0265313_10000993
259 Ga0265313_10001677
260 Ga0265314_10011969
261 Ga0265342_10018152
262 Ga0265342_10041421
263 Ga0316578_10085347
264 Ga0373934_0103809
265 Ga0373941_0128770
266 Ga0373954_0051163
267 Ga0373956_0022524
268 Ga0373946_0148270
269 Ga0373942_0086292
270 Ga0373933_0006504
271 Ga0373947_0295069
272 Ga0373947_0504913
273 Ga0373937_0032996
274 Ga0373937_0112624
275 Ga0316584_0206387
276 Ga0373925_0754560
277 Ga0316581_0208194
278 Ga0453684_0346479
279 Ga0451576_0046022
280 Ga0451576_0088608
281 Ga0451576_0096189
282 Ga0451576_0228661
283 Ga0451576_1367735
284 Ga0495653_0388845
285 Ga0495618_0004601
286 Ga0495628_0074422
287 Ga0495628_0881675
288 Ga0495630_0262075
289 Ga0495630_0484608
290 Ga0495652_0372406
291 Ga0495652_0418841
292 Ga0495640_0079243
293 Ga0495586_0000893
294 Ga0495586_0142047
295 Ga0495587_0221479
296 Ga0495598_0115977
297 Ga0495667_0395562
298 Ga0495634_0003623
299 Ga0495599_0008045
300 Ga0495599_0076971
301 Ga0495658_0070427
302 Ga0495669_0114022
303 Ga0495613_0023357
304 Ga0495613_0094046
305 Ga0495674_0395128
306 Ga0495680_0007926
307 Ga0495677_0144501
308 Ga0495684_0391962
309 Ga0495602_0216749
310 Ga0501031_0000043
311 Ga0501032_0011143
312 Ga0501033_0010249
313 Ga0501039_0185697
314 Ga0501043_0313023
315 Ga0501046_0240525
316 Ga0501217_014205
317 Ga0501257_025642
318 Ga0501232_046825
319 Ga0501035_0001482
320 Ga0501044_0000032
321 Ga0501044_0109053
322 nmdc:mga08y16_1004473_c1
323 nmdc:mga0rr50_335109_c1
324 nmdc:mga08x19_348266_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

30

161

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r03-assembly1.cif.gz_A the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.8681 4 136
6glp-assembly1.cif.gz_A crystal structure of hmth1 n33g in complex with lw14 in the presence of acetate 0.8476 5 161
8i1a-assembly1.cif.gz_A crystal structure of human mth1(g2k mutant) in complex with 8-oxo-dgtp at ph 8.6 0.8466 5 161
6gls-assembly2.cif.gz_B crystal structure of hmth1 n33g in complex with th scaffold 1 in the absence of acetate 0.8455 5 163
3r03-assembly1.cif.gz_A the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.844 4 136
ID Description Score Start End Superfamily
af_Q54BB8_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8459 5 135 3.90.79.10
3a6uA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8327 7 131 3.90.79.10
3grnB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8243 4 135 3.90.79.10
3eesB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8121 5 131 3.90.79.10
3r03B00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8103 1 135 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A7V4IIF2-F1-model_v4 NUDIX hydrolase 0.9621 5 168 GO:0016787
AF-A0A3C0VZC1-F1-model_v4 Nudix hydrolase domain-containing protein 0.9559 1 73 GO:0005737
GO:0016818
AF-A0A2V2RTP8-F1-model_v4 NUDIX hydrolase 0.9558 1 167 GO:0016787
AF-A0A2A4M4F1-F1-model_v4 Nudix hydrolase domain-containing protein 0.9557 1 164
AF-A0A1G3Z757-F1-model_v4 NUDIX hydrolase 0.9552 23 164 GO:0016787

Map