F239383

General Info

Members Datasets Scaffolds Average Seq Length
162 137 324 268

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10004062|Ga0213875_100040626
Length 318
Sequence MLDSFFEAHGLSLDVGSEKAASNLDGHRTCGRLHHGLRSQANRIRRPSPYTLKMAVRVGASVLAEILEHKRSEVADLHARAATLEQAAFERKSPVRPFAEALRAHAPAIIAEIKKASPSKGVLRREFHPAFLAHAYEQGGAACLSVLTDKHFFQGSLLDLEAARAAVAVPVLRKDFVIDRLQIFEAAAHGADAILLIAAALDTNALISFRELARSLGMASLVEVHDRDELARAVDSGAEIIGVNNRSLETFEVSLETSVRLSLLLPSNVVKVSESGIHSAADIQMLRTAGYDAFLVGESLVRAADATAALRALMSEKA

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
44 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
45 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
46 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
47 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
48 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
49 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
50 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
51 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
52 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
53 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
54 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
55 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
56 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
57 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
62 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
63 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
68 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
71 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
72 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
73 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
74 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
75 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
76 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
77 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
78 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
79 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
80 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
81 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
82 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
83 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
84 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
85 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
86 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
87 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
88 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
89 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
90 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
91 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
92 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
93 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
94 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
117 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
118 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
133 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
136 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
137 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 0.62
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 6.79
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10004062 3300021388 Bacteria 8140
2 JGI25406J46586_10000518 3300003203 Bacteria 17996
3 JGI25165J46597_1000003 3300003214 Bacteria 694080
4 rootH2_10157006 3300003320 Unclassified 1545
5 rootH1_10000922 3300003323 Bacteria 7119
6 Ga0070658_10033203 3300005327 Bacteria 4151
7 Ga0070680_100039497 3300005336 Bacteria 3819
8 Ga0070689_100190698 3300005340 Bacteria 1669
9 Ga0070714_100312270 3300005435 Unclassified 1468
10 Ga0070663_100436057 3300005455 Bacteria 1077
11 Ga0070681_10042889 3300005458 Bacteria 4533
12 Ga0070681_10253107 3300005458 Bacteria 1673
13 Ga0070681_10303881 3300005458 Bacteria 1505
14 Ga0070679_100065230 3300005530 Bacteria 3629
15 Ga0068855_100098287 3300005563 Bacteria 3372
16 Ga0068854_100005808 3300005578 Bacteria 7815
17 Ga0068854_100062954 3300005578 Bacteria 2692
18 Ga0068852_100737285 3300005616 Bacteria 997
19 Ga0068859_100283380 3300005617 Bacteria 1750
20 Ga0081455_10011622 3300005937 Bacteria 8833
21 Ga0081455_10031720 3300005937 Bacteria 4774
22 Ga0070712_100589902 3300006175 Bacteria 940
23 Ga0075428_100006018 3300006844 Bacteria 13474
24 Ga0075430_100000026 3300006846 Bacteria 78833
25 Ga0075431_100004659 3300006847 Bacteria 13474
26 Ga0075433_10002454 3300006852 Bacteria 14106
27 Ga0075434_100029801 3300006871 Bacteria 5371
28 Ga0075429_100003174 3300006880 Bacteria 13973
29 Ga0097620_100283376 3300006931 Bacteria 1750
30 Ga0111539_10004795 3300009094 Bacteria 17642
31 Ga0114129_10025014 3300009147 Bacteria 8465
32 Ga0105239_10036385 3300010375 Bacteria 5405
33 Ga0105239_10552674 3300010375 Bacteria 1311
34 Ga0157370_10298317 3300013104 Bacteria 1488
35 Ga0157369_10363976 3300013105 Bacteria 1501
36 Ga0157376_10389628 3300014969 Bacteria 1344
37 Ga0206353_10978940 3300020082 Bacteria 2798
38 Ga0213875_10000002 3300021388 Bacteria 921066
39 Ga0213875_10000038 3300021388 Bacteria 164463
40 Ga0213875_10010938 3300021388 Bacteria 4532
41 Ga0207699_10052566 3300025906 Bacteria 2412
42 Ga0207705_10039115 3300025909 Bacteria 3398
43 Ga0207707_10048634 3300025912 Bacteria 3694
44 Ga0207693_10109062 3300025915 Bacteria 2171
45 Ga0207660_10016056 3300025917 Bacteria 4951
46 Ga0207652_10158304 3300025921 Unclassified 2029
47 Ga0207640_10150123 3300025981 Bacteria 1711
48 Ga0207678_10462414 3300026067 Bacteria 1104
49 Ga0207641_10096065 3300026088 Bacteria 2602
50 Ga0207676_10323803 3300026095 Bacteria 1416
51 Ga0207428_10000140 3300027907 Bacteria 97818
52 Ga0265325_10000821 3300031241 Bacteria 22542
53 Ga0316575_10015535 3300031665 Bacteria 2870
54 Ga0316579_10041740 3300031691 Bacteria 2129
55 Ga0316576_10055235 3300031727 Bacteria 2897
56 Ga0316577_10006485 3300031733 Bacteria 6183
57 Ga0316585_10002951 3300032137 Bacteria 4644
58 Ga0316580_10001936 3300032139 Bacteria 5577
59 Ga0373945_0056990 3300035116 Bacteria 1450
60 Ga0373946_0010870 3300035171 Bacteria 3382
61 Ga0316574_0459882 3300035398 Bacteria 796
62 Ga0373927_0019706 3300035695 Bacteria 4423
63 Ga0373947_0006468 3300035725 Bacteria 6804
64 Ga0316582_0192781 3300036647 Bacteria 1388
65 Ga0316584_0109841 3300036712 Bacteria 2063
66 Ga0373925_0001346 3300037068 Bacteria 21452
67 Ga0373925_0009589 3300037068 Bacteria 7054
68 Ga0395900_0023070 3300037418 Bacteria 6368
69 Ga0395905_0479921 3300037471 Bacteria 1143
70 Ga0316581_0005097 3300037588 Bacteria 3398
71 Ga0436364_0014380 3300037853 Bacteria 6034
72 Ga0436364_0612043 3300037853 Bacteria 326330
73 Ga0436364_0642410 3300037853 Bacteria 16331
74 Ga0436364_0955613 3300037853 Bacteria 12762
75 Ga0436364_0991316 3300037853 Bacteria 187962
76 Ga0436364_1327810 3300037853 Bacteria 5383
77 Ga0436364_1448469 3300037853 Bacteria 1754
78 Ga0400483_103608 3300039062 Bacteria 2409
79 Ga0436365_0864892 3300039437 Bacteria 30275
80 Ga0436360_0450453 3300039438 Bacteria 10377
81 Ga0436361_0126076 3300039447 Bacteria 97470
82 Ga0436362_0151508 3300039453 Bacteria 4512
83 Ga0466968_0006072 3300044735 Bacteria 4536
84 Ga0466960_0007238 3300044901 Bacteria 4495
85 Ga0495592_0116629 3300046454 Bacteria 1884
86 Ga0495603_0000161 3300046455 Bacteria 33937
87 Ga0495629_0000771 3300046459 Bacteria 25859
88 Ga0495580_0000067 3300046472 Bacteria 63149
89 Ga0495582_0000996 3300046473 Bacteria 15865
90 Ga0495594_0000022 3300046499 Bacteria 71881
91 Ga0495666_0022229 3300046526 Bacteria 3140
92 Ga0495652_0114572 3300046529 Bacteria 2162
93 Ga0495665_0028118 3300046531 Bacteria 3017
94 Ga0495645_0325642 3300046543 Bacteria 996
95 Ga0495622_0000329 3300046557 Bacteria 34743
96 Ga0495634_0125136 3300046642 Bacteria 1643
97 Ga0495635_0049680 3300046663 Bacteria 2891
98 Ga0495588_0003072 3300046674 Bacteria 7226
99 Ga0495646_0191750 3300046680 Bacteria 1117
100 Ga0495647_0000954 3300046681 Bacteria 8727
101 Ga0495658_0000760 3300046683 Bacteria 17437
102 Ga0495613_0000597 3300046689 Bacteria 29036
103 Ga0495581_0007376 3300047315 Bacteria 6356
104 Ga0495674_0064574 3300047319 Bacteria 3182
105 Ga0495676_0051749 3300047321 Bacteria 3283
106 Ga0495680_0323681 3300047322 Bacteria 1078
107 Ga0495593_0000226 3300047673 Bacteria 30158
108 Ga0495614_0048830 3300048089 Bacteria 1814
109 Ga0496103_0080850 3300048906 Bacteria 2044
110 Ga0496104_0036204 3300048907 Bacteria 4613
111 Ga0496108_0107111 3300048911 Bacteria 2387
112 Ga0496108_0265678 3300048911 Bacteria 1493
113 Ga0496109_0318194 3300048912 Bacteria 1468
114 Ga0496110_0075205 3300048913 Bacteria 3001
115 Ga0496112_0004714 3300048915 Bacteria 11618
116 Ga0496112_0078653 3300048915 Bacteria 3261
117 Ga0496113_0118402 3300048916 Bacteria 2068
118 Ga0496115_0062379 3300048918 Bacteria 3007
119 Ga0501034_0062593 3300049571 Bacteria 3736
120 Ga0501036_0062840 3300049572 Bacteria 3145
121 Ga0501037_0138307 3300049573 Bacteria 1744
122 Ga0501037_0169755 3300049573 Bacteria 1551
123 Ga0501038_0158413 3300049574 Bacteria 1842
124 Ga0501039_0336042 3300049575 Bacteria 1187
125 Ga0501040_0031976 3300049576 Bacteria 3559
126 Ga0501042_0195896 3300049578 Bacteria 1457
127 Ga0501043_0008047 3300049579 Bacteria 8324
128 Ga0501043_0210593 3300049579 Bacteria 1507
129 Ga0501047_0021676 3300049581 Bacteria 6169
130 Ga0501067_0005050 3300049583 Bacteria 7329
131 Ga0501071_0008494 3300049587 Bacteria 6793
132 Ga0501072_0035087 3300049588 Bacteria 3931
133 Ga0501073_0001791 3300049589 Bacteria 15989
134 Ga0501073_0109858 3300049589 Bacteria 1913
135 Ga0501074_0019688 3300049590 Bacteria 4899
136 Ga0501075_0010575 3300049591 Bacteria 6489
137 Ga0501077_0056057 3300049593 Bacteria 2502
138 Ga0501077_0249408 3300049593 Bacteria 1129
139 Ga0501079_0050604 3300049741 Bacteria 3207
140 Ga0501079_0352288 3300049741 Bacteria 1153
141 Ga0501080_0119997 3300049742 Bacteria 2437
142 Ga0501081_0072464 3300049743 Bacteria 2402
143 Ga0501044_0779202 3300049823 Bacteria 837
144 nmdc:mga05p37_16233_c1 3300050507 Bacteria 8966
145 nmdc:mga09592_13220_c1 3300050508 Bacteria 6740
146 nmdc:mga0qj67_10102_c1 3300050509 Bacteria 7044
147 nmdc:mga06r32_1341_c1 3300050510 Bacteria 22216
148 nmdc:mga08y16_32482_c1 3300050511 Bacteria 5486
149 nmdc:mga0n895_1423_c1 3300050512 Bacteria 17899
150 nmdc:mga0rr50_2292_c1 3300050513 Bacteria 10738
151 nmdc:mga0a205_1897_c1 3300050515 Bacteria 18155
152 Ga0495601_0102808 3300053077 Bacteria 1846
153 Ga0495601_0363534 3300053077 Bacteria 940
154 Ga0495595_0134777 3300053084 Bacteria 1209
155 Ga0495619_0000828 3300053085 Bacteria 20284
156 Ga0495619_0061855 3300053085 Bacteria 2492
157 Ga0501084_0031327 3300054114 Bacteria 4447
158 Ga0501082_0000084 3300060353 Bacteria 70644
159 Ga0501082_0114628 3300060353 Bacteria 2334
160 Ga0530510_0208760 3300061734 Bacteria 1451
161 2765466170 2765235802 Bacteria 5618596
162 2894775166 2894772417 Bacteria 5305674
163 Ga0213875_10004062
164 JGI25406J46586_10000518
165 JGI25165J46597_1000003
166 rootH2_10157006
167 rootH1_10000922
168 Ga0070658_10033203
169 Ga0070680_100039497
170 Ga0070689_100190698
171 Ga0070714_100312270
172 Ga0070663_100436057
173 Ga0070681_10042889
174 Ga0070681_10253107
175 Ga0070681_10303881
176 Ga0070679_100065230
177 Ga0068855_100098287
178 Ga0068854_100005808
179 Ga0068854_100062954
180 Ga0068852_100737285
181 Ga0068859_100283380
182 Ga0081455_10011622
183 Ga0081455_10031720
184 Ga0070712_100589902
185 Ga0075428_100006018
186 Ga0075430_100000026
187 Ga0075431_100004659
188 Ga0075433_10002454
189 Ga0075434_100029801
190 Ga0075429_100003174
191 Ga0097620_100283376
192 Ga0111539_10004795
193 Ga0114129_10025014
194 Ga0105239_10036385
195 Ga0105239_10552674
196 Ga0157370_10298317
197 Ga0157369_10363976
198 Ga0157376_10389628
199 Ga0206353_10978940
200 Ga0213875_10000002
201 Ga0213875_10000038
202 Ga0213875_10010938
203 Ga0207699_10052566
204 Ga0207705_10039115
205 Ga0207707_10048634
206 Ga0207693_10109062
207 Ga0207660_10016056
208 Ga0207652_10158304
209 Ga0207640_10150123
210 Ga0207678_10462414
211 Ga0207641_10096065
212 Ga0207676_10323803
213 Ga0207428_10000140
214 Ga0265325_10000821
215 Ga0316575_10015535
216 Ga0316579_10041740
217 Ga0316576_10055235
218 Ga0316577_10006485
219 Ga0316585_10002951
220 Ga0316580_10001936
221 Ga0373945_0056990
222 Ga0373946_0010870
223 Ga0316574_0459882
224 Ga0373927_0019706
225 Ga0373947_0006468
226 Ga0316582_0192781
227 Ga0316584_0109841
228 Ga0373925_0001346
229 Ga0373925_0009589
230 Ga0395900_0023070
231 Ga0395905_0479921
232 Ga0316581_0005097
233 Ga0436364_0014380
234 Ga0436364_0612043
235 Ga0436364_0642410
236 Ga0436364_0955613
237 Ga0436364_0991316
238 Ga0436364_1327810
239 Ga0436364_1448469
240 Ga0400483_103608
241 Ga0436365_0864892
242 Ga0436360_0450453
243 Ga0436361_0126076
244 Ga0436362_0151508
245 Ga0466968_0006072
246 Ga0466960_0007238
247 Ga0495592_0116629
248 Ga0495603_0000161
249 Ga0495629_0000771
250 Ga0495580_0000067
251 Ga0495582_0000996
252 Ga0495594_0000022
253 Ga0495666_0022229
254 Ga0495652_0114572
255 Ga0495665_0028118
256 Ga0495645_0325642
257 Ga0495622_0000329
258 Ga0495634_0125136
259 Ga0495635_0049680
260 Ga0495588_0003072
261 Ga0495646_0191750
262 Ga0495647_0000954
263 Ga0495658_0000760
264 Ga0495613_0000597
265 Ga0495581_0007376
266 Ga0495674_0064574
267 Ga0495676_0051749
268 Ga0495680_0323681
269 Ga0495593_0000226
270 Ga0495614_0048830
271 Ga0496103_0080850
272 Ga0496104_0036204
273 Ga0496108_0107111
274 Ga0496108_0265678
275 Ga0496109_0318194
276 Ga0496110_0075205
277 Ga0496112_0004714
278 Ga0496112_0078653
279 Ga0496113_0118402
280 Ga0496115_0062379
281 Ga0501034_0062593
282 Ga0501036_0062840
283 Ga0501037_0138307
284 Ga0501037_0169755
285 Ga0501038_0158413
286 Ga0501039_0336042
287 Ga0501040_0031976
288 Ga0501042_0195896
289 Ga0501043_0008047
290 Ga0501043_0210593
291 Ga0501047_0021676
292 Ga0501067_0005050
293 Ga0501071_0008494
294 Ga0501072_0035087
295 Ga0501073_0001791
296 Ga0501073_0109858
297 Ga0501074_0019688
298 Ga0501075_0010575
299 Ga0501077_0056057
300 Ga0501077_0249408
301 Ga0501079_0050604
302 Ga0501079_0352288
303 Ga0501080_0119997
304 Ga0501081_0072464
305 Ga0501044_0779202
306 nmdc:mga05p37_16233_c1
307 nmdc:mga09592_13220_c1
308 nmdc:mga0qj67_10102_c1
309 nmdc:mga06r32_1341_c1
310 nmdc:mga08y16_32482_c1
311 nmdc:mga0n895_1423_c1
312 nmdc:mga0rr50_2292_c1
313 nmdc:mga0a205_1897_c1
314 Ga0495601_0102808
315 Ga0495601_0363534
316 Ga0495595_0134777
317 Ga0495619_0000828
318 Ga0495619_0061855
319 Ga0501084_0031327
320 Ga0501082_0000084
321 Ga0501082_0114628
322 Ga0530510_0208760
323 2765466170
324 2894775166

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00218

IGPS

Indole-3-glycerol phosphate synthase

63

313

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6y88-assembly8.cif.gz_H igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp 0.982 19 276
3t55-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba) 0.9734 19 279
3t78-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with 5-fluoroanthranilate 0.9704 19 278
6y88-assembly7.cif.gz_G igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp 0.9693 34 276
3t40-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) complex with n-2-carboxyphenyl glycine (cpg) 0.9664 19 276
ID Description Score Start End Superfamily
3t40A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9664 19 276 3.20.20.70
af_Q0JCI6_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9585 50 276 3.20.20.70
af_P00909_2_259_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9541 19 276 3.20.20.70
2c3zA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.953 52 272 3.20.20.70
af_B4FS35_106_381_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9524 11 276 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1G3IQ66-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9972 18 257 GO:0000162
GO:0004425
GO:0004640
GO:0006568
AF-A0A529ZQ95-F1-model_v4 deleted 0.9969 83 276
AF-A0A529HIM0-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9964 72 251 GO:0000162
GO:0004425
GO:0004640
AF-A0A529WF14-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9962 18 244 GO:0000162
GO:0004425
GO:0004640
GO:0006568
AF-A0A436E409-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9957 83 276 GO:0000162
GO:0004425
GO:0004640

Map