F238774

General Info

Members Datasets Scaffolds Average Seq Length
162 106 324 275

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100299242|Ga0070684_1002992423
Length 309
Sequence LPPWSQHAQTVRGHDGGMDLSASVNRTPAAFLGHGNPMNALAHNRYTEAWRAFGDAVGRARAILVISAHWYVNATAVTAMPRPRTIHDFYGFPDELFAVDYPAPGAPDVAAEVAEVVKPEWVGLDYDSWGIDHGTWSVLCHAFPMADIPVLQLSINETRPMDYHLDLAARLAPLRERGVCIIGSGNIVHNLHRIDWRHPDAGFDWAQRFDDAARETLIDKPGNVLSLEAHRDFAASVPTPDHFIPMLYLAALADQAGETPEVLVDGYAHGSLSMTAYTLDVSCPAHALSTGGSVPLPDPHLLPPEETNA

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
7 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
8 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
9 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
14 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
19 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
20 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
21 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
22 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
23 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
39 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
40 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
41 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
42 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
43 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
44 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
45 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
46 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
47 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
48 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
49 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
50 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
51 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
52 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
53 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
54 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
55 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
56 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
57 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
58 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
59 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
60 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
61 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
62 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
63 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
64 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
65 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
66 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
80 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
81 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
82 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
83 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
84 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
85 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
86 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
89 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
90 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
91 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
92 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
93 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
96 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
97 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
98 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
99 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
100 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
101 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
104 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
105 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.2
Nodule 0
Rhizoplane 6.17
Rhizosphere 77.78
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100299242 3300005535 Bacteria 1476
2 Ga0068868_100196948 3300005338 Bacteria 1678
3 Ga0070660_100215319 3300005339 Bacteria 1560
4 Ga0070701_10281842 3300005438 Bacteria 1015
5 Ga0070681_10014696 3300005458 Bacteria 7786
6 Ga0068867_100088865 3300005459 Bacteria 2342
7 Ga0070702_100021879 3300005615 Bacteria 3373
8 Ga0068866_10158724 3300005718 Bacteria 1317
9 Ga0081538_10038863 3300005981 Bacteria 3061
10 Ga0075365_10062353 3300006038 Bacteria 2493
11 Ga0075365_10094668 3300006038 Bacteria 2039
12 Ga0075365_10153005 3300006038 Bacteria 1605
13 Ga0075363_100006681 3300006048 Bacteria 5262
14 Ga0075363_100008882 3300006048 Bacteria 4703
15 Ga0075364_10017721 3300006051 Bacteria 4453
16 Ga0075364_10047939 3300006051 Bacteria 2784
17 Ga0075364_10052618 3300006051 Bacteria 2661
18 Ga0075364_10056185 3300006051 Bacteria 2577
19 Ga0075370_10067784 3300006353 Bacteria 2037
20 Ga0111539_10171520 3300009094 Bacteria 2535
21 Ga0105245_10527294 3300009098 Bacteria 1200
22 Ga0105243_10030737 3300009148 Bacteria 4137
23 Ga0105243_10172830 3300009148 Bacteria 1873
24 Ga0105242_10029217 3300009176 Bacteria 4394
25 Ga0105238_10460041 3300009551 Bacteria 1270
26 Ga0105246_10347963 3300011119 Bacteria 1213
27 Ga0157378_10013000 3300013297 Bacteria 7282
28 Ga0157375_10035681 3300013308 Bacteria 4749
29 Ga0157379_10071408 3300014968 Bacteria 3106
30 Ga0209051_1008431 3300025303 Bacteria 5455
31 Ga0207688_10153340 3300025901 Bacteria 1362
32 Ga0207707_10021429 3300025912 Bacteria 5650
33 Ga0207657_10240974 3300025919 Bacteria 1444
34 Ga0207706_10434094 3300025933 Bacteria 1137
35 Ga0207686_10106419 3300025934 Bacteria 1883
36 Ga0207670_10079844 3300025936 Bacteria 2285
37 Ga0207669_10103558 3300025937 Bacteria 1888
38 Ga0207651_10224193 3300025960 Bacteria 1522
39 Ga0207677_10260081 3300026023 Bacteria 1414
40 Ga0207703_10073093 3300026035 Bacteria 2836
41 Ga0207708_10169519 3300026075 Bacteria 1728
42 Ga0207648_10025802 3300026089 Bacteria 5229
43 Ga0207675_100045256 3300026118 Bacteria 4112
44 Ga0207675_100506382 3300026118 Bacteria 1202
45 Ga0268264_10004762 3300028381 Bacteria 11517
46 Ga0265323_10006558 3300028653 Bacteria 4888
47 Ga0400485_03546 3300038735 Bacteria 14800
48 Ga0436365_0983461 3300039437 Bacteria 2568
49 Ga0436362_0155047 3300039453 Bacteria 5370
50 Ga0451793_1443819 3300041452 Bacteria 1279
51 Ga0451807_2057820 3300041486 Bacteria 2524
52 Ga0451853_3629216 3300041512 Bacteria 1895
53 Ga0451577_0147972 3300042876 Bacteria 2112
54 Ga0453683_0001458 3300044673 Bacteria 20407
55 Ga0466965_0073513 3300044683 Bacteria 1721
56 Ga0466961_0163432 3300044693 Unclassified 1387
57 Ga0453684_0000026 3300044712 Bacteria 792958
58 Ga0453684_0008006 3300044712 Bacteria 19131
59 Ga0453684_0158563 3300044712 Bacteria 2679
60 Ga0466968_0055232 3300044735 Bacteria 1704
61 Ga0451576_0000050 3300045051 Bacteria 315118
62 Ga0466958_0095740 3300045836 Bacteria 1841
63 Ga0466967_0154767 3300045976 Bacteria 2146
64 Ga0495653_0114400 3300046463 Bacteria 1933
65 Ga0495652_0410946 3300046529 Bacteria 956
66 Ga0495667_0006542 3300046559 Bacteria 7910
67 Ga0495657_0331319 3300046675 Bacteria 903
68 Ga0495600_0171807 3300046809 Bacteria 1399
69 Ga0495680_0007454 3300047322 Bacteria 10028
70 Ga0496102_0059107 3300048905 Bacteria 3505
71 Ga0496102_0179302 3300048905 Bacteria 1996
72 Ga0496102_0259365 3300048905 Bacteria 1639
73 Ga0496105_0167491 3300048908 Bacteria 1802
74 Ga0496109_0353436 3300048912 Bacteria 1388
75 Ga0496110_0215167 3300048913 Bacteria 1747
76 Ga0496111_0112076 3300048914 Bacteria 2010
77 Ga0496114_0288576 3300048917 Bacteria 1447
78 Ga0501031_0106506 3300049568 Bacteria 1830
79 Ga0501032_0014060 3300049569 Bacteria 5678
80 Ga0501033_0084966 3300049570 Bacteria 2319
81 Ga0501033_0215923 3300049570 Bacteria 1367
82 Ga0501034_0000523 3300049571 Bacteria 61646
83 Ga0501034_0008370 3300049571 Bacteria 10933
84 Ga0501034_0014076 3300049571 Bacteria 8242
85 Ga0501034_0183836 3300049571 Bacteria 2054
86 Ga0501034_0214927 3300049571 Bacteria 1877
87 Ga0501036_0023664 3300049572 Bacteria 5176
88 Ga0501037_0010689 3300049573 Bacteria 6744
89 Ga0501037_0050576 3300049573 Bacteria 3041
90 Ga0501039_0266078 3300049575 Bacteria 1347
91 Ga0501040_0022265 3300049576 Bacteria 4240
92 Ga0501040_0098664 3300049576 Bacteria 2036
93 Ga0501041_0020284 3300049577 Bacteria 3973
94 Ga0501043_0010275 3300049579 Bacteria 7336
95 Ga0501046_0003350 3300049580 Bacteria 14712
96 Ga0501047_0002214 3300049581 Bacteria 18626
97 Ga0501047_0103379 3300049581 Bacteria 2729
98 Ga0501047_0134173 3300049581 Bacteria 2356
99 Ga0501048_0177540 3300049582 Bacteria 1509
100 Ga0501068_0002466 3300049584 Bacteria 9824
101 Ga0501069_0000025 3300049585 Bacteria 109731
102 Ga0501070_0000026 3300049586 Bacteria 150349
103 Ga0501070_0000992 3300049586 Bacteria 25475
104 Ga0501070_0038405 3300049586 Bacteria 3994
105 Ga0501070_0237306 3300049586 Bacteria 1493
106 Ga0501071_0031923 3300049587 Bacteria 3737
107 Ga0501071_0572977 3300049587 Bacteria 867
108 Ga0501072_0013542 3300049588 Bacteria 6241
109 Ga0501072_0038772 3300049588 Bacteria 3739
110 Ga0501072_0095969 3300049588 Bacteria 2356
111 Ga0501072_0359566 3300049588 Bacteria 1156
112 Ga0501073_0000071 3300049589 Bacteria 62958
113 Ga0501073_0011413 3300049589 Bacteria 6501
114 Ga0501074_0001258 3300049590 Bacteria 16753
115 Ga0501074_0007811 3300049590 Bacteria 7745
116 Ga0501074_0101760 3300049590 Bacteria 2057
117 Ga0501074_0240548 3300049590 Bacteria 1287
118 Ga0501075_0054826 3300049591 Bacteria 3000
119 Ga0501075_0154688 3300049591 Bacteria 1748
120 Ga0501076_0066181 3300049592 Bacteria 2884
121 Ga0501076_0068102 3300049592 Bacteria 2843
122 Ga0501077_0003316 3300049593 Bacteria 9686
123 Ga0501077_0139750 3300049593 Bacteria 1536
124 Ga0501079_0001194 3300049741 Bacteria 18200
125 Ga0501079_0002072 3300049741 Bacteria 14374
126 Ga0501080_0002187 3300049742 Bacteria 16987
127 Ga0501080_0003848 3300049742 Bacteria 13260
128 Ga0501080_0011418 3300049742 Bacteria 8134
129 Ga0501080_0031932 3300049742 Bacteria 4908
130 Ga0501080_0096857 3300049742 Bacteria 2739
131 Ga0501080_0332966 3300049742 Bacteria 1373
132 Ga0501080_0385801 3300049742 Bacteria 1262
133 Ga0501081_0053883 3300049743 Bacteria 2778
134 Ga0501083_0008623 3300049744 Bacteria 7194
135 Ga0501083_0145477 3300049744 Bacteria 1552
136 Ga0501035_0050181 3300049822 Bacteria 3740
137 Ga0501035_0437079 3300049822 Bacteria 1084
138 Ga0501044_0005129 3300049823 Bacteria 14608
139 Ga0501044_0387972 3300049823 Bacteria 1311
140 Ga0501045_0022977 3300049824 Bacteria 4469
141 Ga0501045_0212905 3300049824 Bacteria 1439
142 Ga0501045_0530376 3300049824 Bacteria 874
143 nmdc:mga03683_141723_c1 3300050489 Bacteria 1081
144 nmdc:mga03n38_260088_c1 3300050490 Bacteria 920
145 nmdc:mga00v17_114495_c1 3300050491 Bacteria 1713
146 nmdc:mga00v17_31626_c1 3300050491 Bacteria 3122
147 nmdc:mga0yw44_207887_c1 3300050492 Bacteria 1294
148 nmdc:mga0yw44_233718_c1 3300050492 Bacteria 1220
149 nmdc:mga0yw44_72550_c1 3300050492 Bacteria 2140
150 nmdc:mga0yw44_85079_c1 3300050492 Bacteria 1989
151 nmdc:mga06z11_17030_c1 3300050494 Bacteria 3289
152 nmdc:mga07m45_14920_c1 3300050496 Bacteria 4148
153 nmdc:mga07m45_26096_c1 3300050496 Bacteria 2540
154 nmdc:mga05p37_850861_c1 3300050507 Bacteria 990
155 nmdc:mga08y16_158701_c1 3300050511 Bacteria 2350
156 Ga0500616_0025223 3300053153 Bacteria 3298
157 Ga0501084_0025612 3300054114 Bacteria 4920
158 Ga0501084_0055690 3300054114 Bacteria 3308
159 Ga0501082_0140839 3300060353 Bacteria 2093
160 Ga0501082_0227566 3300060353 Bacteria 1623
161 Ga0501082_0234400 3300060353 Bacteria 1597
162 Ga0501082_0315728 3300060353 Bacteria 1361
163 Ga0070684_100299242
164 Ga0068868_100196948
165 Ga0070660_100215319
166 Ga0070701_10281842
167 Ga0070681_10014696
168 Ga0068867_100088865
169 Ga0070702_100021879
170 Ga0068866_10158724
171 Ga0081538_10038863
172 Ga0075365_10062353
173 Ga0075365_10094668
174 Ga0075365_10153005
175 Ga0075363_100006681
176 Ga0075363_100008882
177 Ga0075364_10017721
178 Ga0075364_10047939
179 Ga0075364_10052618
180 Ga0075364_10056185
181 Ga0075370_10067784
182 Ga0111539_10171520
183 Ga0105245_10527294
184 Ga0105243_10030737
185 Ga0105243_10172830
186 Ga0105242_10029217
187 Ga0105238_10460041
188 Ga0105246_10347963
189 Ga0157378_10013000
190 Ga0157375_10035681
191 Ga0157379_10071408
192 Ga0209051_1008431
193 Ga0207688_10153340
194 Ga0207707_10021429
195 Ga0207657_10240974
196 Ga0207706_10434094
197 Ga0207686_10106419
198 Ga0207670_10079844
199 Ga0207669_10103558
200 Ga0207651_10224193
201 Ga0207677_10260081
202 Ga0207703_10073093
203 Ga0207708_10169519
204 Ga0207648_10025802
205 Ga0207675_100045256
206 Ga0207675_100506382
207 Ga0268264_10004762
208 Ga0265323_10006558
209 Ga0400485_03546
210 Ga0436365_0983461
211 Ga0436362_0155047
212 Ga0451793_1443819
213 Ga0451807_2057820
214 Ga0451853_3629216
215 Ga0451577_0147972
216 Ga0453683_0001458
217 Ga0466965_0073513
218 Ga0466961_0163432
219 Ga0453684_0000026
220 Ga0453684_0008006
221 Ga0453684_0158563
222 Ga0466968_0055232
223 Ga0451576_0000050
224 Ga0466958_0095740
225 Ga0466967_0154767
226 Ga0495653_0114400
227 Ga0495652_0410946
228 Ga0495667_0006542
229 Ga0495657_0331319
230 Ga0495600_0171807
231 Ga0495680_0007454
232 Ga0496102_0059107
233 Ga0496102_0179302
234 Ga0496102_0259365
235 Ga0496105_0167491
236 Ga0496109_0353436
237 Ga0496110_0215167
238 Ga0496111_0112076
239 Ga0496114_0288576
240 Ga0501031_0106506
241 Ga0501032_0014060
242 Ga0501033_0084966
243 Ga0501033_0215923
244 Ga0501034_0000523
245 Ga0501034_0008370
246 Ga0501034_0014076
247 Ga0501034_0183836
248 Ga0501034_0214927
249 Ga0501036_0023664
250 Ga0501037_0010689
251 Ga0501037_0050576
252 Ga0501039_0266078
253 Ga0501040_0022265
254 Ga0501040_0098664
255 Ga0501041_0020284
256 Ga0501043_0010275
257 Ga0501046_0003350
258 Ga0501047_0002214
259 Ga0501047_0103379
260 Ga0501047_0134173
261 Ga0501048_0177540
262 Ga0501068_0002466
263 Ga0501069_0000025
264 Ga0501070_0000026
265 Ga0501070_0000992
266 Ga0501070_0038405
267 Ga0501070_0237306
268 Ga0501071_0031923
269 Ga0501071_0572977
270 Ga0501072_0013542
271 Ga0501072_0038772
272 Ga0501072_0095969
273 Ga0501072_0359566
274 Ga0501073_0000071
275 Ga0501073_0011413
276 Ga0501074_0001258
277 Ga0501074_0007811
278 Ga0501074_0101760
279 Ga0501074_0240548
280 Ga0501075_0054826
281 Ga0501075_0154688
282 Ga0501076_0066181
283 Ga0501076_0068102
284 Ga0501077_0003316
285 Ga0501077_0139750
286 Ga0501079_0001194
287 Ga0501079_0002072
288 Ga0501080_0002187
289 Ga0501080_0003848
290 Ga0501080_0011418
291 Ga0501080_0031932
292 Ga0501080_0096857
293 Ga0501080_0332966
294 Ga0501080_0385801
295 Ga0501081_0053883
296 Ga0501083_0008623
297 Ga0501083_0145477
298 Ga0501035_0050181
299 Ga0501035_0437079
300 Ga0501044_0005129
301 Ga0501044_0387972
302 Ga0501045_0022977
303 Ga0501045_0212905
304 Ga0501045_0530376
305 nmdc:mga03683_141723_c1
306 nmdc:mga03n38_260088_c1
307 nmdc:mga00v17_114495_c1
308 nmdc:mga00v17_31626_c1
309 nmdc:mga0yw44_207887_c1
310 nmdc:mga0yw44_233718_c1
311 nmdc:mga0yw44_72550_c1
312 nmdc:mga0yw44_85079_c1
313 nmdc:mga06z11_17030_c1
314 nmdc:mga07m45_14920_c1
315 nmdc:mga07m45_26096_c1
316 nmdc:mga05p37_850861_c1
317 nmdc:mga08y16_158701_c1
318 Ga0500616_0025223
319 Ga0501084_0025612
320 Ga0501084_0055690
321 Ga0501082_0140839
322 Ga0501082_0227566
323 Ga0501082_0234400
324 Ga0501082_0315728

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

34

279

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pw6-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein jw3007 from escherichia coli k12 0.8654 6 259
2pw6-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein jw3007 from escherichia coli k12 0.8587 6 259
8iq8-assembly1.cif.gz_D crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii 0.7729 5 257
8iq8-assembly1.cif.gz_D crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii 0.7517 5 257
7txy-assembly2.cif.gz_E crystal structure of the 2-aminophenol 1,6-dioxygenase from the aro bacterial microcompartment of micromonospora rosaria 0.7478 4 258
ID Description Score Start End Superfamily
af_P24197_1_271_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9261 1 259 3.40.830.10
af_P24197_1_271_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9193 1 259 3.40.830.10
af_Q54W77_1_267_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9007 4 257 3.40.830.10
af_I1MQB9_2_262_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8845 7 257 3.40.830.10
af_Q54W77_1_267_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8781 4 257 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A7W0X297-F1-model_v4 4,5-DOPA dioxygenase extradiol (EC 1.13.11.29) 0.9675 6 162 GO:0008198
GO:0008270
GO:0050297
AF-A0A4Q5Y7Z1-F1-model_v4 deleted 0.9607 3 164
AF-A0A6D2G2Z1-F1-model_v4 Uncharacterized protein ygiD (EC 1.13.-.-) 0.9546 1 143 GO:0008198
GO:0008270
GO:0016701
AF-A0A533TEC6-F1-model_v4 deleted 0.9534 1 160
AF-A0A2V9QCK1-F1-model_v4 Extradiol ring-cleavage dioxygenase class III enzyme subunit B domain-containing protein 0.9519 17 161 GO:0008198
GO:0008270
GO:0016701

Map