F237968

General Info

Members Datasets Scaffolds Average Seq Length
161 118 322 126

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_300165_c1|nmdc:mga08y16_300165_c1_767_1219
Length 150
Sequence MTDTSRKPTFTWPGAIRDAQHREIDMRAFLALALIAAIPSIGQAAVPVATVAMSNFSFTPGTVELQAGVPVVLHLNNLAGGGHNFSAPAFFKAAKLDPQAAALVHNGKVEVPAHSAVDLALVPAEGQYPLKCTHTLHSSFGMKGTISVHK

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
96 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
97 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
98 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
99 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
100 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
101 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
102 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
112 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
113 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
114 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
115 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
116 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
117 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
118 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 1.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.97
Nodule 0
Rhizoplane 5.59
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 23.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_300165_c1 3300050511 Bacteria 1655
2 Ga0065715_10320028 3300005293 Unclassified 1004
3 Ga0070676_11196057 3300005328 Unclassified 577
4 Ga0070670_100393810 3300005331 Bacteria 1222
5 Ga0070677_10424225 3300005333 Bacteria 706
6 Ga0070666_10437290 3300005335 Unclassified 944
7 Ga0070660_100013454 3300005339 Bacteria 5870
8 Ga0070660_100020237 3300005339 Bacteria 4888
9 Ga0070660_100272872 3300005339 Bacteria 1383
10 Ga0070660_100351608 3300005339 Bacteria 1214
11 Ga0070661_100286906 3300005344 Bacteria 1278
12 Ga0070692_10013363 3300005345 Bacteria 3825
13 Ga0070692_10027464 3300005345 Bacteria 2821
14 Ga0070668_100895493 3300005347 Unclassified 793
15 Ga0070675_100364530 3300005354 Bacteria 1284
16 Ga0070671_100131424 3300005355 Bacteria 2108
17 Ga0070671_100163217 3300005355 Bacteria 1883
18 Ga0070673_101837528 3300005364 Unclassified 574
19 Ga0070659_100032203 3300005366 Bacteria 4065
20 Ga0070659_100260266 3300005366 Bacteria 1439
21 Ga0070659_100973678 3300005366 Bacteria 744
22 Ga0070667_100681351 3300005367 Unclassified 950
23 Ga0070700_101729657 3300005441 Unclassified 537
24 Ga0070678_101306629 3300005456 Bacteria 675
25 Ga0070678_101744124 3300005456 Unclassified 586
26 Ga0070681_10204612 3300005458 Bacteria 1891
27 Ga0070679_100363536 3300005530 Bacteria 1394
28 Ga0070684_100191182 3300005535 Bacteria 1863
29 Ga0068853_100025796 3300005539 Bacteria 4933
30 Ga0068853_100634358 3300005539 Bacteria 1016
31 Ga0070672_100907864 3300005543 Unclassified 778
32 Ga0070693_100086370 3300005547 Bacteria 1882
33 Ga0070665_100001845 3300005548 Bacteria 24057
34 Ga0070665_100004335 3300005548 Bacteria 14923
35 Ga0068855_100449186 3300005563 Bacteria 1407
36 Ga0068855_101061506 3300005563 Unclassified 848
37 Ga0068856_100210426 3300005614 Bacteria 1960
38 Ga0068852_100235065 3300005616 Bacteria 1749
39 Ga0068859_100037123 3300005617 Bacteria 4890
40 Ga0068864_100754377 3300005618 Unclassified 954
41 Ga0068863_100026160 3300005841 Bacteria 5568
42 Ga0068863_100192909 3300005841 Unclassified 1958
43 Ga0068860_100096375 3300005843 Bacteria 2820
44 Ga0068860_100413390 3300005843 Unclassified 1336
45 Ga0075369_10184176 3300006186 Unclassified 961
46 Ga0068871_100531568 3300006358 Unclassified 1063
47 Ga0097620_100037123 3300006931 Bacteria 4890
48 Ga0105240_10741419 3300009093 Bacteria 1069
49 Ga0105245_10006215 3300009098 Bacteria 10505
50 Ga0105247_10230150 3300009101 Bacteria 1258
51 Ga0105243_11322967 3300009148 Bacteria 738
52 Ga0105242_11280385 3300009176 Bacteria 756
53 Ga0105248_10012683 3300009177 Bacteria 9299
54 Ga0105248_10227328 3300009177 Bacteria 2100
55 Ga0105249_10436068 3300009553 Bacteria 1347
56 Ga0157371_10000624 3300013102 Bacteria 42051
57 Ga0157371_10391441 3300013102 Bacteria 1016
58 Ga0157370_10252301 3300013104 Bacteria 1632
59 Ga0157380_11168795 3300014326 Bacteria 812
60 Ga0157377_10825584 3300014745 Bacteria 686
61 Ga0163161_10091864 3300017792 Bacteria 2247
62 Ga0163161_10849618 3300017792 Bacteria 770
63 Ga0206356_10745250 3300020070 Bacteria 4863
64 Ga0206353_11260964 3300020082 Unclassified 1005
65 Ga0213876_10029512 3300021384 Bacteria 2889
66 Ga0213875_10002530 3300021388 Bacteria 10907
67 Ga0207697_10061787 3300025315 Unclassified 1559
68 Ga0207680_10369213 3300025903 Bacteria 1010
69 Ga0207705_10003117 3300025909 Bacteria 12645
70 Ga0207705_10039405 3300025909 Bacteria 3386
71 Ga0207705_10067483 3300025909 Bacteria 2588
72 Ga0207705_10381003 3300025909 Bacteria 1089
73 Ga0207707_10759348 3300025912 Unclassified 810
74 Ga0207695_10426852 3300025913 Bacteria 1209
75 Ga0207660_10520108 3300025917 Bacteria 966
76 Ga0207662_10774640 3300025918 Bacteria 675
77 Ga0207657_10008064 3300025919 Bacteria 10740
78 Ga0207657_10010513 3300025919 Bacteria 9230
79 Ga0207657_10192573 3300025919 Bacteria 1644
80 Ga0207657_10291339 3300025919 Bacteria 1294
81 Ga0207652_10264615 3300025921 Bacteria 1551
82 Ga0207650_11185017 3300025925 Bacteria 650
83 Ga0207659_10830332 3300025926 Bacteria 794
84 Ga0207687_10026428 3300025927 Bacteria 3887
85 Ga0207687_10288307 3300025927 Bacteria 1318
86 Ga0207644_10164076 3300025931 Bacteria 1729
87 Ga0207644_11459370 3300025931 Unclassified 574
88 Ga0207690_10028271 3300025932 Bacteria 3553
89 Ga0207690_11814162 3300025932 Unclassified 509
90 Ga0207669_10368404 3300025937 Bacteria 1116
91 Ga0207691_10178916 3300025940 Bacteria 1854
92 Ga0207711_10061578 3300025941 Bacteria 3236
93 Ga0207711_10150427 3300025941 Bacteria 2100
94 Ga0207689_10193916 3300025942 Bacteria 1676
95 Ga0207661_10208175 3300025944 Bacteria 1723
96 Ga0207667_10936213 3300025949 Unclassified 856
97 Ga0207668_11061624 3300025972 Bacteria 725
98 Ga0207658_10010723 3300025986 Bacteria 6231
99 Ga0207678_11072781 3300026067 Unclassified 713
100 Ga0207702_10676731 3300026078 Bacteria 1016
101 Ga0207641_10011963 3300026088 Bacteria 7119
102 Ga0207675_101735394 3300026118 Bacteria 644
103 Ga0207683_10513544 3300026121 Unclassified 1107
104 Ga0207698_10114757 3300026142 Bacteria 2266
105 Ga0268266_10000992 3300028379 Bacteria 35787
106 Ga0268266_10002205 3300028379 Bacteria 21315
107 Ga0268264_10077634 3300028381 Bacteria 2829
108 Ga0307408_100251995 3300031548 Unclassified 1457
109 Ga0307413_10403298 3300031824 Bacteria 1072
110 Ga0307410_10433234 3300031852 Bacteria 1069
111 Ga0307416_100652411 3300032002 Bacteria 1137
112 Ga0307414_10191089 3300032004 Bacteria 1657
113 Ga0307415_101358770 3300032126 Bacteria 675
114 Ga0373931_1251710 3300035691 Unclassified 509
115 Ga0395899_0000230 3300037312 Bacteria 76090
116 Ga0395899_0088367 3300037312 Bacteria 2249
117 Ga0395899_0137350 3300037312 Bacteria 1742
118 Ga0395900_0000124 3300037418 Bacteria 133210
119 Ga0395900_0328318 3300037418 Bacteria 1508
120 Ga0395900_0394437 3300037418 Bacteria 1349
121 Ga0395900_0731117 3300037418 Bacteria 921
122 Ga0395900_0951989 3300037418 Unclassified 780
123 Ga0395900_1079284 3300037418 Unclassified 721
124 Ga0395898_0065246 3300037466 Bacteria 3530
125 Ga0395898_0285292 3300037466 Bacteria 1575
126 Ga0395898_0628349 3300037466 Bacteria 1016
127 Ga0395905_0431998 3300037471 Bacteria 1214
128 Ga0395905_0806576 3300037471 Bacteria 841
129 Ga0395905_0851887 3300037471 Bacteria 814
130 Ga0436364_0354297 3300037853 Bacteria 35362
131 Ga0395901_0000031 3300038443 Bacteria 241733
132 Ga0395901_0062509 3300038443 Bacteria 3874
133 Ga0395901_0285218 3300038443 Unclassified 1715
134 Ga0395901_0426624 3300038443 Bacteria 1359
135 Ga0395901_0877346 3300038443 Bacteria 880
136 Ga0436365_0321715 3300039437 Bacteria 770
137 Ga0436365_1581676 3300039437 Bacteria 2843
138 Ga0451789_1318816 3300041443 Unclassified 674
139 Ga0451793_0694130 3300041452 Bacteria 737
140 Ga0451797_0340177 3300041453 Unclassified 546
141 Ga0439464_0073265 3300042439 Bacteria 1015
142 Ga0450916_038220 3300042530 Bacteria 722
143 Ga0450893_0102713 3300042532 Unclassified 584
144 Ga0495605_0368961 3300046474 Unclassified 600
145 Ga0495616_0431816 3300046513 Unclassified 536
146 Ga0495625_0404948 3300046660 Bacteria 851
147 Ga0495669_0285294 3300046684 Unclassified 795
148 Ga0496101_0079933 3300048904 Bacteria 2414
149 Ga0496102_0392798 3300048905 Bacteria 1305
150 Ga0496105_1360794 3300048908 Unclassified 516
151 Ga0496106_0737332 3300048909 Unclassified 784
152 Ga0496114_0042483 3300048917 Bacteria 3769
153 Ga0496115_0133644 3300048918 Bacteria 2045
154 Ga0496126_0088792 3300048929 Bacteria 2722
155 nmdc:mga07m45_906779_c1 3300050496 Bacteria 504
156 Ga0500658_0221339 3300053134 Unclassified 868
157 Ga0500568_0011566 3300053139 Bacteria 4085
158 Ga0500604_0000036 3300053151 Bacteria 51659
159 Ga0500616_0000827 3300053153 Bacteria 34996
160 Ga0500611_158333 3300053727 Unclassified 625
161 Ga0500587_002181 3300053739 Bacteria 2791
162 nmdc:mga08y16_300165_c1
163 Ga0065715_10320028
164 Ga0070676_11196057
165 Ga0070670_100393810
166 Ga0070677_10424225
167 Ga0070666_10437290
168 Ga0070660_100013454
169 Ga0070660_100020237
170 Ga0070660_100272872
171 Ga0070660_100351608
172 Ga0070661_100286906
173 Ga0070692_10013363
174 Ga0070692_10027464
175 Ga0070668_100895493
176 Ga0070675_100364530
177 Ga0070671_100131424
178 Ga0070671_100163217
179 Ga0070673_101837528
180 Ga0070659_100032203
181 Ga0070659_100260266
182 Ga0070659_100973678
183 Ga0070667_100681351
184 Ga0070700_101729657
185 Ga0070678_101306629
186 Ga0070678_101744124
187 Ga0070681_10204612
188 Ga0070679_100363536
189 Ga0070684_100191182
190 Ga0068853_100025796
191 Ga0068853_100634358
192 Ga0070672_100907864
193 Ga0070693_100086370
194 Ga0070665_100001845
195 Ga0070665_100004335
196 Ga0068855_100449186
197 Ga0068855_101061506
198 Ga0068856_100210426
199 Ga0068852_100235065
200 Ga0068859_100037123
201 Ga0068864_100754377
202 Ga0068863_100026160
203 Ga0068863_100192909
204 Ga0068860_100096375
205 Ga0068860_100413390
206 Ga0075369_10184176
207 Ga0068871_100531568
208 Ga0097620_100037123
209 Ga0105240_10741419
210 Ga0105245_10006215
211 Ga0105247_10230150
212 Ga0105243_11322967
213 Ga0105242_11280385
214 Ga0105248_10012683
215 Ga0105248_10227328
216 Ga0105249_10436068
217 Ga0157371_10000624
218 Ga0157371_10391441
219 Ga0157370_10252301
220 Ga0157380_11168795
221 Ga0157377_10825584
222 Ga0163161_10091864
223 Ga0163161_10849618
224 Ga0206356_10745250
225 Ga0206353_11260964
226 Ga0213876_10029512
227 Ga0213875_10002530
228 Ga0207697_10061787
229 Ga0207680_10369213
230 Ga0207705_10003117
231 Ga0207705_10039405
232 Ga0207705_10067483
233 Ga0207705_10381003
234 Ga0207707_10759348
235 Ga0207695_10426852
236 Ga0207660_10520108
237 Ga0207662_10774640
238 Ga0207657_10008064
239 Ga0207657_10010513
240 Ga0207657_10192573
241 Ga0207657_10291339
242 Ga0207652_10264615
243 Ga0207650_11185017
244 Ga0207659_10830332
245 Ga0207687_10026428
246 Ga0207687_10288307
247 Ga0207644_10164076
248 Ga0207644_11459370
249 Ga0207690_10028271
250 Ga0207690_11814162
251 Ga0207669_10368404
252 Ga0207691_10178916
253 Ga0207711_10061578
254 Ga0207711_10150427
255 Ga0207689_10193916
256 Ga0207661_10208175
257 Ga0207667_10936213
258 Ga0207668_11061624
259 Ga0207658_10010723
260 Ga0207678_11072781
261 Ga0207702_10676731
262 Ga0207641_10011963
263 Ga0207675_101735394
264 Ga0207683_10513544
265 Ga0207698_10114757
266 Ga0268266_10000992
267 Ga0268266_10002205
268 Ga0268264_10077634
269 Ga0307408_100251995
270 Ga0307413_10403298
271 Ga0307410_10433234
272 Ga0307416_100652411
273 Ga0307414_10191089
274 Ga0307415_101358770
275 Ga0373931_1251710
276 Ga0395899_0000230
277 Ga0395899_0088367
278 Ga0395899_0137350
279 Ga0395900_0000124
280 Ga0395900_0328318
281 Ga0395900_0394437
282 Ga0395900_0731117
283 Ga0395900_0951989
284 Ga0395900_1079284
285 Ga0395898_0065246
286 Ga0395898_0285292
287 Ga0395898_0628349
288 Ga0395905_0431998
289 Ga0395905_0806576
290 Ga0395905_0851887
291 Ga0436364_0354297
292 Ga0395901_0000031
293 Ga0395901_0062509
294 Ga0395901_0285218
295 Ga0395901_0426624
296 Ga0395901_0877346
297 Ga0436365_0321715
298 Ga0436365_1581676
299 Ga0451789_1318816
300 Ga0451793_0694130
301 Ga0451797_0340177
302 Ga0439464_0073265
303 Ga0450916_038220
304 Ga0450893_0102713
305 Ga0495605_0368961
306 Ga0495616_0431816
307 Ga0495625_0404948
308 Ga0495669_0285294
309 Ga0496101_0079933
310 Ga0496102_0392798
311 Ga0496105_1360794
312 Ga0496106_0737332
313 Ga0496114_0042483
314 Ga0496115_0133644
315 Ga0496126_0088792
316 nmdc:mga07m45_906779_c1
317 Ga0500658_0221339
318 Ga0500568_0011566
319 Ga0500604_0000036
320 Ga0500616_0000827
321 Ga0500611_158333
322 Ga0500587_002181

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00127

Copper-bind

Copper binding proteins, plastocyanin/azurin family

45

149

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tk2-assembly3.cif.gz_C crystal structure of uncharacterized cupredoxin-like domain protein from bacillus anthracis 0.9217 21 124
5tk2-assembly3.cif.gz_C crystal structure of uncharacterized cupredoxin-like domain protein from bacillus anthracis 0.9118 21 124
4hcf-assembly2.cif.gz_B crystal structure of uncharacterized cupredoxin-like domain protein cupredoxin_1 with copper bound from bacillus anthracis 0.8926 18 124
4hcf-assembly2.cif.gz_B crystal structure of uncharacterized cupredoxin-like domain protein cupredoxin_1 with copper bound from bacillus anthracis 0.8394 18 124
1iby-assembly1.cif.gz_C red copper protein nitrosocyanin from nitrosomonas europaea 0.8343 32 125
ID Description Score Start End Superfamily
4hcfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8689 20 124 2.60.40.420
4hcfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8595 20 124 2.60.40.420
1ibyB00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8364 32 125 2.60.40.420
4f2eA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8084 23 124 2.60.40.420
af_F1QC68_381_727_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.793 39 125 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A840HXP8-F1-model_v4 Plastocyanin 0.9903 15 124 GO:0030313
AF-A0A7T2GJ44-F1-model_v4 Cupredoxin domain-containing protein 0.988 21 124
AF-A0A7Z0AQQ6-F1-model_v4 deleted 0.9858 24 124
AF-A0A502CKR7-F1-model_v4 Copper-binding protein 0.9852 21 124 GO:0005507
GO:0009055
GO:0030313
AF-A0A2U2J6N4-F1-model_v4 Copper-binding protein 0.9789 21 124 GO:0030313

Map