F237791

General Info

Members Datasets Scaffolds Average Seq Length
161 73 322 128

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0115876|Ga0496104_0115876_1127_1660
Length 152
Sequence MSTDPGGVSGEAGPEGRPPTEEELRAAYEAEIARVKVEQVLLEHVVTLINLGMRRTGLVPGTEAERDPTQVRVAIDAIRAQLPLLEQTAPQQISPIRDALSQLQLAYVKIGGAPGPAVGDAPPEGEPGAGPPPKPGEAGPAQRSGRLWVPGQ

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
10 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
11 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
12 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
13 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
14 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
15 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
16 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
26 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
27 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
28 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
29 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
30 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
31 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
32 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
33 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
34 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
35 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
36 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
37 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
38 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
39 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
40 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
41 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
42 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
43 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
44 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
45 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
46 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
47 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
48 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
49 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
50 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
51 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
52 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
53 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
54 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
55 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
56 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
57 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
58 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
59 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
60 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
61 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
62 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
63 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
64 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
65 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
66 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
67 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
68 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
69 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
70 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
71 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
72 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
73 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.97
Rhizosphere 72.67
Stem 0
Stem Tuber 0
Unclassified 9.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0115876 3300048907 Bacteria 2571
2 Ga0070683_100348407 3300005329 Bacteria 1410
3 Ga0070668_100079875 3300005347 Bacteria 2561
4 Ga0070714_100097114 3300005435 Bacteria 2589
5 Ga0070714_100781807 3300005435 Bacteria 924
6 Ga0070714_100954624 3300005435 Bacteria 833
7 Ga0070714_101150128 3300005435 Archaea 757
8 Ga0070713_100173589 3300005436 Bacteria 1932
9 Ga0070710_10060708 3300005437 Bacteria 2151
10 Ga0070710_10327142 3300005437 Bacteria 1008
11 Ga0070711_100983938 3300005439 Unclassified 723
12 Ga0081540_1130003 3300005983 Bacteria 1030
13 Ga0070717_10022893 3300006028 Bacteria 4943
14 Ga0070717_10272388 3300006028 Bacteria 1500
15 Ga0070717_10715389 3300006028 Unclassified 910
16 Ga0070712_100018993 3300006175 Bacteria 4474
17 Ga0105249_10188749 3300009553 Bacteria 2010
18 Ga0213873_10052798 3300021358 Bacteria 1081
19 Ga0213874_10000786 3300021377 Bacteria 6438
20 Ga0213874_10001218 3300021377 Bacteria 5284
21 Ga0213874_10006023 3300021377 Bacteria 2852
22 Ga0213876_10002937 3300021384 Bacteria 9876
23 Ga0213876_10019302 3300021384 Bacteria 3601
24 Ga0213876_10100565 3300021384 Bacteria 1532
25 Ga0213876_10222821 3300021384 Bacteria 1003
26 Ga0213875_10010871 3300021388 Bacteria 4550
27 Ga0213875_10013574 3300021388 Bacteria 3994
28 Ga0213875_10017981 3300021388 Bacteria 3411
29 Ga0213875_10138006 3300021388 Bacteria 1141
30 Ga0207692_10018257 3300025898 Bacteria 3145
31 Ga0207699_10021400 3300025906 Bacteria 3484
32 Ga0207693_10000783 3300025915 Bacteria 28458
33 Ga0207663_10189421 3300025916 Unclassified 1476
34 Ga0207700_10117811 3300025928 Bacteria 2148
35 Ga0207700_10151466 3300025928 Bacteria 1917
36 Ga0207664_10420849 3300025929 Bacteria 1190
37 Ga0207664_10591826 3300025929 Bacteria 996
38 Ga0207665_11026078 3300025939 Bacteria 657
39 Ga0207712_10196642 3300025961 Bacteria 1595
40 Ga0207668_10050487 3300025972 Bacteria 2867
41 Ga0307410_10802428 3300031852 Bacteria 801
42 Ga0307409_102289116 3300031995 Bacteria 570
43 Ga0307416_101389475 3300032002 Bacteria 808
44 Ga0307416_101989982 3300032002 Bacteria 684
45 Ga0307416_103794627 3300032002 Bacteria 506
46 Ga0373933_0031916 3300035724 Bacteria 3059
47 Ga0436364_0159196 3300037853 Bacteria 2267
48 Ga0436364_0562420 3300037853 Bacteria 3297
49 Ga0436364_0617202 3300037853 Bacteria 29703
50 Ga0436364_0671072 3300037853 Unclassified 588
51 Ga0436364_0705467 3300037853 Bacteria 5245
52 Ga0436364_0958477 3300037853 Bacteria 6661
53 Ga0436364_1163030 3300037853 Bacteria 816
54 Ga0436364_1415383 3300037853 Bacteria 4997
55 Ga0395901_1322996 3300038443 Bacteria 682
56 Ga0436365_0158003 3300039437 Bacteria 3927
57 Ga0436365_0165172 3300039437 Bacteria 761
58 Ga0436365_0177810 3300039437 Bacteria 13192
59 Ga0436365_0188858 3300039437 Bacteria 3442
60 Ga0436365_0416351 3300039437 Bacteria 35590
61 Ga0436365_0639813 3300039437 Bacteria 21703
62 Ga0436365_0800235 3300039437 Bacteria 2339
63 Ga0436365_0851957 3300039437 Bacteria 868
64 Ga0436365_0923158 3300039437 Bacteria 6983
65 Ga0436365_1142944 3300039437 Bacteria 8296
66 Ga0436365_1292969 3300039437 Bacteria 3583
67 Ga0436360_1245815 3300039438 Unclassified 839
68 Ga0436360_1257705 3300039438 Bacteria 1373
69 Ga0436363_0426840 3300039450 Bacteria 14866
70 Ga0436363_0528757 3300039450 Bacteria 16264
71 Ga0436363_0741008 3300039450 Bacteria 3660
72 Ga0436363_1206787 3300039450 Unclassified 702
73 Ga0436363_1319702 3300039450 Bacteria 521
74 Ga0436363_1592535 3300039450 Unclassified 1899
75 Ga0436362_0222520 3300039453 Bacteria 1748
76 Ga0436362_0379796 3300039453 Unclassified 897
77 Ga0436362_0628129 3300039453 Bacteria 1961
78 Ga0436362_0685169 3300039453 Bacteria 851
79 Ga0436362_0853260 3300039453 Bacteria 1697
80 Ga0466969_0047753 3300044656 Bacteria 2118
81 Ga0466969_0127970 3300044656 Bacteria 1179
82 Ga0466966_0036295 3300044684 Bacteria 3183
83 Ga0466966_0112733 3300044684 Bacteria 1675
84 Ga0466966_0130149 3300044684 Bacteria 1541
85 Ga0466966_0851000 3300044684 Unclassified 550
86 Ga0466961_0004411 3300044693 Bacteria 8807
87 Ga0466961_0013138 3300044693 Bacteria 5298
88 Ga0466963_0000352 3300044694 Bacteria 20819
89 Ga0466963_0012988 3300044694 Bacteria 5105
90 Ga0466963_0120434 3300044694 Bacteria 1805
91 Ga0466963_0153374 3300044694 Unclassified 1600
92 Ga0466964_0015537 3300044706 Bacteria 2899
93 Ga0466971_0000920 3300044719 Bacteria 12081
94 Ga0466971_0075740 3300044719 Unclassified 1530
95 Ga0466971_0076976 3300044719 Bacteria 1518
96 Ga0466971_0300761 3300044719 Unclassified 770
97 Ga0466968_0003927 3300044735 Bacteria 5521
98 Ga0466968_0041825 3300044735 Bacteria 1936
99 Ga0466968_0062868 3300044735 Bacteria 1604
100 Ga0466968_0267480 3300044735 Bacteria 815
101 Ga0466968_0428352 3300044735 Unclassified 652
102 Ga0466970_0042981 3300044765 Bacteria 2404
103 Ga0466970_0104420 3300044765 Bacteria 1545
104 Ga0466970_0407554 3300044765 Bacteria 776
105 Ga0466957_0011593 3300044842 Bacteria 5094
106 Ga0466957_0029931 3300044842 Bacteria 3249
107 Ga0466957_0506962 3300044842 Bacteria 837
108 Ga0466957_1037462 3300044842 Bacteria 590
109 Ga0466959_0002616 3300045049 Bacteria 11559
110 Ga0466959_0003891 3300045049 Bacteria 9908
111 Ga0466959_0025348 3300045049 Bacteria 4394
112 Ga0466959_0031637 3300045049 Bacteria 3915
113 Ga0466959_0038816 3300045049 Bacteria 3518
114 Ga0466959_0076669 3300045049 Bacteria 2413
115 Ga0466959_0146537 3300045049 Bacteria 1666
116 Ga0466959_0149066 3300045049 Unclassified 1650
117 Ga0466959_0156488 3300045049 Bacteria 1604
118 Ga0466959_0177030 3300045049 Bacteria 1494
119 Ga0466959_0211909 3300045049 Bacteria 1346
120 Ga0466959_0216918 3300045049 Bacteria 1328
121 Ga0466958_0000502 3300045836 Bacteria 16435
122 Ga0466958_0001290 3300045836 Bacteria 11775
123 Ga0466958_0003412 3300045836 Bacteria 8247
124 Ga0466958_0003807 3300045836 Bacteria 7879
125 Ga0466958_0018057 3300045836 Bacteria 4088
126 Ga0466958_0035165 3300045836 Bacteria 2993
127 Ga0466967_0011411 3300045976 Bacteria 6728
128 Ga0466967_0015284 3300045976 Bacteria 6013
129 Ga0466967_0172151 3300045976 Bacteria 2038
130 Ga0466967_0311086 3300045976 Bacteria 1517
131 Ga0466967_0926467 3300045976 Bacteria 867
132 Ga0466967_2081629 3300045976 Unclassified 564
133 Ga0495592_0020778 3300046454 Bacteria 4995
134 Ga0495629_0187998 3300046459 Bacteria 1430
135 Ga0495651_0351730 3300046462 Bacteria 973
136 Ga0495653_0003496 3300046463 Bacteria 12637
137 Ga0495608_0001650 3300046511 Bacteria 16046
138 Ga0495618_0433986 3300046514 Bacteria 799
139 Ga0495628_0027977 3300046516 Bacteria 4584
140 Ga0495652_0007386 3300046529 Bacteria 10131
141 Ga0495587_0022809 3300046536 Bacteria 3851
142 Ga0495667_0001941 3300046559 Bacteria 13672
143 Ga0495635_0015408 3300046663 Bacteria 5347
144 Ga0495657_0004891 3300046675 Bacteria 10665
145 Ga0495599_0024217 3300046678 Bacteria 3796
146 Ga0495646_0062772 3300046680 Bacteria 2208
147 Ga0495604_0048206 3300047317 Bacteria 3314
148 Ga0495680_0002342 3300047322 Bacteria 19434
149 Ga0495684_0011702 3300047471 Bacteria 6773
150 Ga0496100_0523732 3300048903 Bacteria 915
151 Ga0496104_0174283 3300048907 Bacteria 2061
152 Ga0496105_0049099 3300048908 Bacteria 3483
153 Ga0496106_0246715 3300048909 Bacteria 1427
154 Ga0496110_0230525 3300048913 Bacteria 1684
155 Ga0496113_0015803 3300048916 Bacteria 5201
156 Ga0496114_0164985 3300048917 Bacteria 1928
157 Ga0495612_0036808 3300053078 Bacteria 1986
158 Ga0495595_0046878 3300053084 Bacteria 1992
159 Ga0495619_0010478 3300053085 Bacteria 5831
160 Ga0466962_0218652 3300061719 Bacteria 933
161 Ga0466962_0383867 3300061719 Bacteria 702
162 Ga0496104_0115876
163 Ga0070683_100348407
164 Ga0070668_100079875
165 Ga0070714_100097114
166 Ga0070714_100781807
167 Ga0070714_100954624
168 Ga0070714_101150128
169 Ga0070713_100173589
170 Ga0070710_10060708
171 Ga0070710_10327142
172 Ga0070711_100983938
173 Ga0081540_1130003
174 Ga0070717_10022893
175 Ga0070717_10272388
176 Ga0070717_10715389
177 Ga0070712_100018993
178 Ga0105249_10188749
179 Ga0213873_10052798
180 Ga0213874_10000786
181 Ga0213874_10001218
182 Ga0213874_10006023
183 Ga0213876_10002937
184 Ga0213876_10019302
185 Ga0213876_10100565
186 Ga0213876_10222821
187 Ga0213875_10010871
188 Ga0213875_10013574
189 Ga0213875_10017981
190 Ga0213875_10138006
191 Ga0207692_10018257
192 Ga0207699_10021400
193 Ga0207693_10000783
194 Ga0207663_10189421
195 Ga0207700_10117811
196 Ga0207700_10151466
197 Ga0207664_10420849
198 Ga0207664_10591826
199 Ga0207665_11026078
200 Ga0207712_10196642
201 Ga0207668_10050487
202 Ga0307410_10802428
203 Ga0307409_102289116
204 Ga0307416_101389475
205 Ga0307416_101989982
206 Ga0307416_103794627
207 Ga0373933_0031916
208 Ga0436364_0159196
209 Ga0436364_0562420
210 Ga0436364_0617202
211 Ga0436364_0671072
212 Ga0436364_0705467
213 Ga0436364_0958477
214 Ga0436364_1163030
215 Ga0436364_1415383
216 Ga0395901_1322996
217 Ga0436365_0158003
218 Ga0436365_0165172
219 Ga0436365_0177810
220 Ga0436365_0188858
221 Ga0436365_0416351
222 Ga0436365_0639813
223 Ga0436365_0800235
224 Ga0436365_0851957
225 Ga0436365_0923158
226 Ga0436365_1142944
227 Ga0436365_1292969
228 Ga0436360_1245815
229 Ga0436360_1257705
230 Ga0436363_0426840
231 Ga0436363_0528757
232 Ga0436363_0741008
233 Ga0436363_1206787
234 Ga0436363_1319702
235 Ga0436363_1592535
236 Ga0436362_0222520
237 Ga0436362_0379796
238 Ga0436362_0628129
239 Ga0436362_0685169
240 Ga0436362_0853260
241 Ga0466969_0047753
242 Ga0466969_0127970
243 Ga0466966_0036295
244 Ga0466966_0112733
245 Ga0466966_0130149
246 Ga0466966_0851000
247 Ga0466961_0004411
248 Ga0466961_0013138
249 Ga0466963_0000352
250 Ga0466963_0012988
251 Ga0466963_0120434
252 Ga0466963_0153374
253 Ga0466964_0015537
254 Ga0466971_0000920
255 Ga0466971_0075740
256 Ga0466971_0076976
257 Ga0466971_0300761
258 Ga0466968_0003927
259 Ga0466968_0041825
260 Ga0466968_0062868
261 Ga0466968_0267480
262 Ga0466968_0428352
263 Ga0466970_0042981
264 Ga0466970_0104420
265 Ga0466970_0407554
266 Ga0466957_0011593
267 Ga0466957_0029931
268 Ga0466957_0506962
269 Ga0466957_1037462
270 Ga0466959_0002616
271 Ga0466959_0003891
272 Ga0466959_0025348
273 Ga0466959_0031637
274 Ga0466959_0038816
275 Ga0466959_0076669
276 Ga0466959_0146537
277 Ga0466959_0149066
278 Ga0466959_0156488
279 Ga0466959_0177030
280 Ga0466959_0211909
281 Ga0466959_0216918
282 Ga0466958_0000502
283 Ga0466958_0001290
284 Ga0466958_0003412
285 Ga0466958_0003807
286 Ga0466958_0018057
287 Ga0466958_0035165
288 Ga0466967_0011411
289 Ga0466967_0015284
290 Ga0466967_0172151
291 Ga0466967_0311086
292 Ga0466967_0926467
293 Ga0466967_2081629
294 Ga0495592_0020778
295 Ga0495629_0187998
296 Ga0495651_0351730
297 Ga0495653_0003496
298 Ga0495608_0001650
299 Ga0495618_0433986
300 Ga0495628_0027977
301 Ga0495652_0007386
302 Ga0495587_0022809
303 Ga0495667_0001941
304 Ga0495635_0015408
305 Ga0495657_0004891
306 Ga0495599_0024217
307 Ga0495646_0062772
308 Ga0495604_0048206
309 Ga0495680_0002342
310 Ga0495684_0011702
311 Ga0496100_0523732
312 Ga0496104_0174283
313 Ga0496105_0049099
314 Ga0496106_0246715
315 Ga0496110_0230525
316 Ga0496113_0015803
317 Ga0496114_0164985
318 Ga0495612_0036808
319 Ga0495595_0046878
320 Ga0495619_0010478
321 Ga0466962_0218652
322 Ga0466962_0383867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uj6-assembly1.cif.gz_A structure of surface layer protein sbsc, domains 1-6 0.7382 18 106
7qv3-assembly1.cif.gz_t bacillus subtilis muts2-collided disome complex (muts2 conf.2; leading 70s) 0.6703 18 105
7qv2-assembly1.cif.gz_t bacillus subtilis collided disome (collided 70s) 0.6702 18 105
6gxo-assembly1.cif.gz_t cryo-em structure of a rotated e. coli 70s ribosome in complex with rf3-gdpcp, rf1(gaq) and p/e-trna (state iv) 0.657 21 106
8cdv-assembly1.cif.gz_S rnase r bound to a 30s degradation intermediate (state ii) 0.6568 18 105
ID Description Score Start End Superfamily
af_P00960_215_296_1.20.58.180 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 0.8182 34 110 1.20.58.180
5f5wA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 0.8002 35 111 1.20.58.180
4a25D01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7878 64 115 1.20.1260.10
af_A0A1D8PJW1_4_96_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.7694 34 110 1.20.58.400
2ra1A03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7684 32 106 1.20.58.770
ID Description Score Start End GO Terms
AF-A0A6V8Q8T4-F1-model_v4 DUF1844 domain-containing protein 0.8879 12 108
AF-A0A7V9RVW0-F1-model_v4 DUF1844 domain-containing protein 0.8567 1 101
AF-A0A1W7D3K9-F1-model_v4 DUF1844 domain-containing protein 0.8541 20 106
AF-A0A2W6CXQ4-F1-model_v4 Recombinase RecA 0.8504 26 106
AF-A0A7V9RVW0-F1-model_v4 DUF1844 domain-containing protein 0.8399 1 101

Map