F236248

General Info

Members Datasets Scaffolds Average Seq Length
161 138 161 96

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100120801|Ga0070668_1001208011
Length 98
Sequence MAEHRQVPEPGETIYAPRPSWGPVFFAIGALGLICGTFASGFIFAPKIWGLIGLIFLLAAFRSIVRGSVRDYYRLPRRQEVRGAALPVETISGPPRAQ

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
89 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
90 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
91 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
136 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 10.56
Rhizosphere 86.34
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1026769 3300000546 Unclassified 617
2 JGI25406J46586_10070815 3300003203 Bacteria 1095
3 Ga0070683_100006417 3300005329 Bacteria 9863
4 Ga0070683_100009649 3300005329 Bacteria 8260
5 Ga0070670_100144916 3300005331 Bacteria 2055
6 Ga0070666_10030539 3300005335 Bacteria 3551
7 Ga0068868_100022371 3300005338 Bacteria 4770
8 Ga0070687_100085516 3300005343 Bacteria 1731
9 Ga0070661_100000004 3300005344 Bacteria 243876
10 Ga0070668_100120801 3300005347 Bacteria 2094
11 Ga0070675_100000050 3300005354 Bacteria 72016
12 Ga0070671_100061637 3300005355 Bacteria 3124
13 Ga0070673_100572939 3300005364 Bacteria 1027
14 Ga0070688_100000010 3300005365 Bacteria 84103
15 Ga0070688_100000686 3300005365 Bacteria 16820
16 Ga0070713_100486707 3300005436 Bacteria 1163
17 Ga0070710_10154265 3300005437 Bacteria 1419
18 Ga0070711_100047966 3300005439 Bacteria 2918
19 Ga0070700_100714685 3300005441 Bacteria 798
20 Ga0070678_100007037 3300005456 Bacteria 6650
21 Ga0070685_10000010 3300005466 Bacteria 146946
22 Ga0070685_10001080 3300005466 Bacteria 14623
23 Ga0070684_100111225 3300005535 Bacteria 2456
24 Ga0070684_100204170 3300005535 Bacteria 1800
25 Ga0070684_100315429 3300005535 Bacteria 1436
26 Ga0070672_100000031 3300005543 Bacteria 62241
27 Ga0070686_100166436 3300005544 Bacteria 1556
28 Ga0070693_100725333 3300005547 Bacteria 730
29 Ga0070665_100002868 3300005548 Bacteria 18629
30 Ga0070665_100038076 3300005548 Bacteria 4835
31 Ga0070665_100467901 3300005548 Bacteria 1271
32 Ga0070665_101210830 3300005548 Unclassified 766
33 Ga0070665_101499073 3300005548 Bacteria 683
34 Ga0070704_100291644 3300005549 Bacteria 1356
35 Ga0070664_100052530 3300005564 Bacteria 3453
36 Ga0068857_101641337 3300005577 Bacteria 628
37 Ga0068852_100000994 3300005616 Bacteria 18720
38 Ga0068852_100063963 3300005616 Bacteria 3205
39 Ga0068851_10003112 3300005834 Bacteria 7354
40 Ga0068863_100121298 3300005841 Bacteria 2493
41 Ga0068862_101090938 3300005844 Bacteria 793
42 Ga0081539_10000776 3300005985 Bacteria 62705
43 Ga0070712_100000841 3300006175 Bacteria 18240
44 Ga0075430_100086767 3300006846 Bacteria 2619
45 Ga0068865_101561911 3300006881 Bacteria 592
46 Ga0105245_10000117 3300009098 Bacteria 76863
47 Ga0105247_10050849 3300009101 Bacteria 2551
48 Ga0105247_10078003 3300009101 Unclassified 2083
49 Ga0105243_10007042 3300009148 Bacteria 8652
50 Ga0105241_10116429 3300009174 Bacteria 2146
51 Ga0105249_11034453 3300009553 Bacteria 890
52 Ga0157371_10004888 3300013102 Bacteria 11513
53 Ga0157369_10001730 3300013105 Bacteria 26528
54 Ga0157378_10016178 3300013297 Bacteria 6532
55 Ga0157378_10149338 3300013297 Bacteria 2176
56 Ga0157375_10009414 3300013308 Bacteria 8576
57 Ga0157380_10000007 3300014326 Bacteria 157634
58 Ga0157379_10712100 3300014968 Bacteria 943
59 Ga0157376_10078125 3300014969 Bacteria 2833
60 Ga0207656_10017412 3300025321 Bacteria 2815
61 Ga0207692_10126787 3300025898 Bacteria 1437
62 Ga0207710_10041562 3300025900 Unclassified 2039
63 Ga0207680_10007123 3300025903 Bacteria 5437
64 Ga0207693_10010825 3300025915 Bacteria 7404
65 Ga0207662_10941107 3300025918 Bacteria 612
66 Ga0207649_10000003 3300025920 Bacteria 388908
67 Ga0207650_10030751 3300025925 Bacteria 3871
68 Ga0207659_10000055 3300025926 Bacteria 74252
69 Ga0207687_10000070 3300025927 Bacteria 77432
70 Ga0207700_10000003 3300025928 Bacteria 500797
71 Ga0207709_10003313 3300025935 Bacteria 9648
72 Ga0207704_10000104 3300025938 Bacteria 46614
73 Ga0207704_11253647 3300025938 Bacteria 633
74 Ga0207691_10000178 3300025940 Bacteria 60110
75 Ga0207711_10000011 3300025941 Bacteria 518817
76 Ga0207661_10002281 3300025944 Bacteria 13216
77 Ga0207661_10004619 3300025944 Bacteria 9651
78 Ga0207668_11093609 3300025972 Bacteria 714
79 Ga0207658_10056859 3300025986 Bacteria 2905
80 Ga0207677_10009001 3300026023 Bacteria 5602
81 Ga0207678_11697084 3300026067 Bacteria 555
82 Ga0207708_10524947 3300026075 Bacteria 995
83 Ga0207702_10000105 3300026078 Bacteria 97835
84 Ga0207641_10076027 3300026088 Bacteria 2902
85 Ga0207674_11043826 3300026116 Bacteria 786
86 Ga0207683_10167842 3300026121 Bacteria 1987
87 Ga0207698_10000015 3300026142 Bacteria 207368
88 Ga0207698_10044308 3300026142 Bacteria 3342
89 Ga0268266_10000526 3300028379 Bacteria 53404
90 Ga0268266_10015588 3300028379 Bacteria 6515
91 Ga0268266_10060957 3300028379 Bacteria 3253
92 Ga0268265_12430781 3300028380 Bacteria 530
93 Ga0265319_1000010 3300028563 Bacteria 188773
94 Ga0265322_10070946 3300028654 Bacteria 988
95 Ga0265336_10047644 3300028666 Bacteria 1301
96 Ga0265338_10000287 3300028800 Bacteria 90818
97 Ga0265324_10101630 3300029957 Bacteria 977
98 Ga0265325_10028601 3300031241 Bacteria 3003
99 Ga0265331_10370694 3300031250 Bacteria 642
100 Ga0265313_10124893 3300031595 Bacteria 1119
101 Ga0265342_10144521 3300031712 Bacteria 1325
102 Ga0307405_10978015 3300031731 Bacteria 721
103 Ga0307416_103064029 3300032002 Bacteria 559
104 Ga0307415_100649460 3300032126 Bacteria 945
105 Ga0316583_10248539 3300032133 Unclassified 616
106 Ga0451807_1783664 3300041486 Unclassified 504
107 Ga0451839_1033735 3300041496 Bacteria 627
108 Ga0451845_0036765 3300041501 Unclassified 695
109 Ga0451853_2804839 3300041512 Bacteria 2000
110 Ga0466957_0001268 3300044842 Bacteria 13149
111 Ga0466957_0441928 3300044842 Bacteria 895
112 Ga0466958_0025743 3300045836 Bacteria 3472
113 Ga0466967_0000002 3300045976 Bacteria 219994
114 Ga0495592_0444648 3300046454 Bacteria 813
115 Ga0495629_0000828 3300046459 Bacteria 25082
116 Ga0495638_0040838 3300046460 Bacteria 2938
117 Ga0495585_0600906 3300046492 Bacteria 517
118 Ga0495606_0000017 3300046507 Bacteria 284549
119 Ga0495608_0000013 3300046511 Bacteria 228481
120 Ga0495628_0003421 3300046516 Bacteria 14207
121 Ga0495630_0000032 3300046517 Bacteria 134425
122 Ga0495587_0405674 3300046536 Bacteria 757
123 Ga0495625_0000243 3300046660 Bacteria 85589
124 Ga0495588_0000073 3300046674 Bacteria 219005
125 Ga0495657_0000003 3300046675 Bacteria 279680
126 Ga0495647_0010829 3300046681 Bacteria 3114
127 Ga0495658_0016938 3300046683 Bacteria 3756
128 Ga0495613_0000027 3300046689 Bacteria 146674
129 Ga0495624_0000691 3300046690 Bacteria 26457
130 Ga0495604_0000723 3300047317 Bacteria 27948
131 Ga0495674_0000039 3300047319 Bacteria 97645
132 Ga0495676_0007903 3300047321 Bacteria 9752
133 Ga0495675_0000002 3300047444 Bacteria 216469
134 Ga0495593_0411574 3300047673 Unclassified 676
135 Ga0495602_0009482 3300048088 Bacteria 10121
136 Ga0495602_0156364 3300048088 Bacteria 1785
137 Ga0496100_0000001 3300048903 Bacteria 530179
138 Ga0496101_0000028 3300048904 Bacteria 198664
139 Ga0496102_0758629 3300048905 Bacteria 893
140 Ga0496104_0583396 3300048907 Unclassified 1028
141 Ga0496106_0000218 3300048909 Bacteria 40075
142 Ga0496107_0000002 3300048910 Bacteria 320871
143 Ga0496108_0000005 3300048911 Bacteria 535059
144 Ga0496108_0681115 3300048911 Bacteria 892
145 Ga0496109_0000002 3300048912 Bacteria 443393
146 Ga0496109_0000221 3300048912 Bacteria 56054
147 Ga0496110_0193784 3300048913 Bacteria 1845
148 Ga0496111_0005704 3300048914 Bacteria 8021
149 Ga0496111_0137654 3300048914 Bacteria 1809
150 Ga0496112_0021401 3300048915 Bacteria 6150
151 Ga0496113_0000005 3300048916 Bacteria 105956
152 Ga0496113_0594285 3300048916 Bacteria 886
153 Ga0496124_0371825 3300048927 Bacteria 1003
154 Ga0501042_0009362 3300049578 Bacteria 6526
155 Ga0501076_0016445 3300049592 Bacteria 5609
156 nmdc:mga0yw44_504095_c1 3300050492 Bacteria 821
157 nmdc:mga0qj67_308438_c1 3300050509 Bacteria 1282
158 Ga0495601_0000017 3300053077 Bacteria 204209
159 Ga0495612_0010356 3300053078 Bacteria 3772
160 Ga0495595_0000007 3300053084 Bacteria 228504
161 Ga0495619_0000026 3300053085 Bacteria 167387

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100144916 Ga0070670_1001449163 84
2 3300005365 Ga0070688_100000686 Ga0070688_1000006869 84
3 3300005466 Ga0070685_10001080 Ga0070685_1000108013 84
4 3300005616 Ga0068852_100000994 Ga0068852_1000009944 84
5 3300026142 Ga0207698_10000015 Ga0207698_10000015100 84
6 3300046511 Ga0495608_0000013 Ga0495608_0000013_92463_92720 84
7 3300046675 Ga0495657_0000003 Ga0495657_0000003_143662_143919 84
8 3300047444 Ga0495675_0000002 Ga0495675_0000002_143662_143919 84
9 3300050492 nmdc:mga0yw44_504095_c1 nmdc:mga0yw44_504095_c1_498_755 84
10 3300053084 Ga0495595_0000007 Ga0495595_0000007_92486_92743 84
11 3300053085 Ga0495619_0000026 Ga0495619_0000026_79821_80078 84
12 3300009098 Ga0105245_10000117 Ga0105245_100001179 86
13 3300025927 Ga0207687_10000070 Ga0207687_1000007085 86
14 3300005549 Ga0070704_100291644 Ga0070704_1002916442 93
15 3300045836 Ga0466958_0025743 Ga0466958_0025743_210_491 93
16 3300005437 Ga0070710_10154265 Ga0070710_101542652 94
17 3300025898 Ga0207692_10126787 Ga0207692_101267873 94
18 3300046516 Ga0495628_0003421 Ga0495628_0003421_7919_8203 94
19 3300048088 Ga0495602_0009482 Ga0495602_0009482_9621_9905 94
20 3300005548 Ga0070665_101499073 Ga0070665_1014990732 95
21 3300047321 Ga0495676_0007903 Ga0495676_0007903_2155_2442 95
22 3300048903 Ga0496100_0000001 Ga0496100_0000001_80182_80469 95
23 3300048904 Ga0496101_0000028 Ga0496101_0000028_80171_80458 95
24 3300048909 Ga0496106_0000218 Ga0496106_0000218_13185_13472 95
25 3300048910 Ga0496107_0000002 Ga0496107_0000002_168019_168306 95
26 3300000546 LJNas_1026769 LJNas_10267692 96
27 3300003203 JGI25406J46586_10070815 JGI25406J46586_100708151 96
28 3300005329 Ga0070683_100006417 Ga0070683_1000064177 96
29 3300005329 Ga0070683_100009649 Ga0070683_10000964910 96
30 3300005335 Ga0070666_10030539 Ga0070666_100305392 96
31 3300005338 Ga0068868_100022371 Ga0068868_1000223714 96
32 3300005343 Ga0070687_100085516 Ga0070687_1000855162 96
33 3300005344 Ga0070661_100000004 Ga0070661_100000004232 96
34 3300005347 Ga0070668_100120801 Ga0070668_1001208011 96
35 3300005354 Ga0070675_100000050 Ga0070675_10000005034 96
36 3300005355 Ga0070671_100061637 Ga0070671_1000616374 96
37 3300005364 Ga0070673_100572939 Ga0070673_1005729392 96
38 3300005365 Ga0070688_100000010 Ga0070688_10000001014 96
39 3300005436 Ga0070713_100486707 Ga0070713_1004867071 96
40 3300005439 Ga0070711_100047966 Ga0070711_1000479662 96
41 3300005441 Ga0070700_100714685 Ga0070700_1007146851 96
42 3300005456 Ga0070678_100007037 Ga0070678_1000070374 96
43 3300005466 Ga0070685_10000010 Ga0070685_10000010113 96
44 3300005535 Ga0070684_100111225 Ga0070684_1001112252 96
45 3300005535 Ga0070684_100204170 Ga0070684_1002041703 96
46 3300005535 Ga0070684_100315429 Ga0070684_1003154293 96
47 3300005543 Ga0070672_100000031 Ga0070672_10000003159 96
48 3300005544 Ga0070686_100166436 Ga0070686_1001664363 96
49 3300005547 Ga0070693_100725333 Ga0070693_1007253331 96
50 3300005548 Ga0070665_100002868 Ga0070665_10000286810 96
51 3300005548 Ga0070665_100038076 Ga0070665_1000380764 96
52 3300005548 Ga0070665_100467901 Ga0070665_1004679011 96
53 3300005548 Ga0070665_101210830 Ga0070665_1012108302 96
54 3300005564 Ga0070664_100052530 Ga0070664_1000525303 96
55 3300005577 Ga0068857_101641337 Ga0068857_1016413372 96
56 3300005616 Ga0068852_100063963 Ga0068852_1000639634 96
57 3300005834 Ga0068851_10003112 Ga0068851_100031125 96
58 3300005841 Ga0068863_100121298 Ga0068863_1001212983 96
59 3300005844 Ga0068862_101090938 Ga0068862_1010909383 96
60 3300005985 Ga0081539_10000776 Ga0081539_1000077627 96
61 3300006175 Ga0070712_100000841 Ga0070712_10000084122 96
62 3300006846 Ga0075430_100086767 Ga0075430_1000867672 96
63 3300006881 Ga0068865_101561911 Ga0068865_1015619112 96
64 3300009101 Ga0105247_10050849 Ga0105247_100508492 96
65 3300009101 Ga0105247_10078003 Ga0105247_100780034 96
66 3300009148 Ga0105243_10007042 Ga0105243_100070429 96
67 3300009174 Ga0105241_10116429 Ga0105241_101164294 96
68 3300009553 Ga0105249_11034453 Ga0105249_110344532 96
69 3300013102 Ga0157371_10004888 Ga0157371_100048882 96
70 3300013105 Ga0157369_10001730 Ga0157369_1000173025 96
71 3300013297 Ga0157378_10016178 Ga0157378_100161783 96
72 3300013297 Ga0157378_10149338 Ga0157378_101493383 96
73 3300013308 Ga0157375_10009414 Ga0157375_1000941410 96
74 3300014326 Ga0157380_10000007 Ga0157380_1000000735 96
75 3300014968 Ga0157379_10712100 Ga0157379_107121002 96
76 3300014969 Ga0157376_10078125 Ga0157376_100781252 96
77 3300025321 Ga0207656_10017412 Ga0207656_100174123 96
78 3300025900 Ga0207710_10041562 Ga0207710_100415623 96
79 3300025903 Ga0207680_10007123 Ga0207680_100071235 96
80 3300025915 Ga0207693_10010825 Ga0207693_1001082510 96
81 3300025918 Ga0207662_10941107 Ga0207662_109411072 96
82 3300025920 Ga0207649_10000003 Ga0207649_1000000327 96
83 3300025925 Ga0207650_10030751 Ga0207650_100307513 96
84 3300025926 Ga0207659_10000055 Ga0207659_1000005536 96
85 3300025928 Ga0207700_10000003 Ga0207700_10000003178 96
86 3300025935 Ga0207709_10003313 Ga0207709_100033139 96
87 3300025938 Ga0207704_10000104 Ga0207704_1000010420 96
88 3300025938 Ga0207704_11253647 Ga0207704_112536472 96
89 3300025940 Ga0207691_10000178 Ga0207691_1000017826 96
90 3300025941 Ga0207711_10000011 Ga0207711_10000011387 96
91 3300025944 Ga0207661_10002281 Ga0207661_1000228110 96
92 3300025944 Ga0207661_10004619 Ga0207661_100046194 96
93 3300025972 Ga0207668_11093609 Ga0207668_110936091 96
94 3300025986 Ga0207658_10056859 Ga0207658_100568595 96
95 3300026023 Ga0207677_10009001 Ga0207677_100090015 96
96 3300026067 Ga0207678_11697084 Ga0207678_116970841 96
97 3300026075 Ga0207708_10524947 Ga0207708_105249472 96
98 3300026078 Ga0207702_10000105 Ga0207702_1000010595 96
99 3300026088 Ga0207641_10076027 Ga0207641_100760274 96
100 3300026116 Ga0207674_11043826 Ga0207674_110438263 96
101 3300026121 Ga0207683_10167842 Ga0207683_101678423 96
102 3300026142 Ga0207698_10044308 Ga0207698_100443083 96
103 3300028379 Ga0268266_10000526 Ga0268266_1000052633 96
104 3300028379 Ga0268266_10015588 Ga0268266_100155884 96
105 3300028379 Ga0268266_10060957 Ga0268266_100609571 96
106 3300028380 Ga0268265_12430781 Ga0268265_124307812 96
107 3300028563 Ga0265319_1000010 Ga0265319_100001044 96
108 3300028654 Ga0265322_10070946 Ga0265322_100709463 96
109 3300028666 Ga0265336_10047644 Ga0265336_100476443 96
110 3300028800 Ga0265338_10000287 Ga0265338_1000028765 96
111 3300029957 Ga0265324_10101630 Ga0265324_101016301 96
112 3300031241 Ga0265325_10028601 Ga0265325_100286013 96
113 3300031250 Ga0265331_10370694 Ga0265331_103706943 96
114 3300031595 Ga0265313_10124893 Ga0265313_101248933 96
115 3300031712 Ga0265342_10144521 Ga0265342_101445211 96
116 3300031731 Ga0307405_10978015 Ga0307405_109780152 96
117 3300032002 Ga0307416_103064029 Ga0307416_1030640292 96
118 3300032126 Ga0307415_100649460 Ga0307415_1006494603 96
119 3300032133 Ga0316583_10248539 Ga0316583_102485392 96
120 3300041486 Ga0451807_1783664 Ga0451807_1783664_69_377 96
121 3300041496 Ga0451839_1033735 Ga0451839_1033735_12_305 96
122 3300041501 Ga0451845_0036765 Ga0451845_0036765_51_347 96
123 3300041512 Ga0451853_2804839 Ga0451853_2804839_386_679 96
124 3300044842 Ga0466957_0001268 Ga0466957_0001268_256_549 96
125 3300044842 Ga0466957_0441928 Ga0466957_0441928_164_457 96
126 3300045976 Ga0466967_0000002 Ga0466967_0000002_31675_31968 96
127 3300046454 Ga0495592_0444648 Ga0495592_0444648_255_548 96
128 3300046459 Ga0495629_0000828 Ga0495629_0000828_21804_22097 96
129 3300046460 Ga0495638_0040838 Ga0495638_0040838_309_602 96
130 3300046492 Ga0495585_0600906 Ga0495585_0600906_166_459 96
131 3300046507 Ga0495606_0000017 Ga0495606_0000017_56795_57088 96
132 3300046517 Ga0495630_0000032 Ga0495630_0000032_74268_74561 96
133 3300046536 Ga0495587_0405674 Ga0495587_0405674_359_652 96
134 3300046660 Ga0495625_0000243 Ga0495625_0000243_75952_76245 96
135 3300046674 Ga0495588_0000073 Ga0495588_0000073_173370_173663 96
136 3300046681 Ga0495647_0010829 Ga0495647_0010829_2354_2647 96
137 3300046683 Ga0495658_0016938 Ga0495658_0016938_2403_2696 96
138 3300046689 Ga0495613_0000027 Ga0495613_0000027_136510_136803 96
139 3300046690 Ga0495624_0000691 Ga0495624_0000691_17313_17606 96
140 3300047317 Ga0495604_0000723 Ga0495604_0000723_21289_21582 96
141 3300047319 Ga0495674_0000039 Ga0495674_0000039_86029_86319 96
142 3300047673 Ga0495593_0411574 Ga0495593_0411574_244_537 96
143 3300048088 Ga0495602_0156364 Ga0495602_0156364_614_907 96
144 3300048905 Ga0496102_0758629 Ga0496102_0758629_341_631 96
145 3300048907 Ga0496104_0583396 Ga0496104_0583396_461_754 96
146 3300048911 Ga0496108_0000005 Ga0496108_0000005_432399_432692 96
147 3300048911 Ga0496108_0681115 Ga0496108_0681115_283_573 96
148 3300048912 Ga0496109_0000002 Ga0496109_0000002_102400_102693 96
149 3300048912 Ga0496109_0000221 Ga0496109_0000221_47249_47539 96
150 3300048913 Ga0496110_0193784 Ga0496110_0193784_451_744 96
151 3300048914 Ga0496111_0005704 Ga0496111_0005704_449_742 96
152 3300048914 Ga0496111_0137654 Ga0496111_0137654_256_549 96
153 3300048915 Ga0496112_0021401 Ga0496112_0021401_236_529 96
154 3300048916 Ga0496113_0000005 Ga0496113_0000005_89153_89446 96
155 3300048916 Ga0496113_0594285 Ga0496113_0594285_217_510 96
156 3300048927 Ga0496124_0371825 Ga0496124_0371825_125_418 96
157 3300049578 Ga0501042_0009362 Ga0501042_0009362_2611_2904 96
158 3300049592 Ga0501076_0016445 Ga0501076_0016445_3082_3372 96
159 3300050509 nmdc:mga0qj67_308438_c1 nmdc:mga0qj67_308438_c1_387_680 96
160 3300053077 Ga0495601_0000017 Ga0495601_0000017_9981_10274 96
161 3300053078 Ga0495612_0010356 Ga0495612_0010356_1714_2007 96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s1k-assembly1.cif.gz_E e. coli core signaling unit, carrying qqqq receptor mutation 0.8285 22 73
1g4y-assembly1.cif.gz_B-2 1.60 a crystal structure of the gating domain from small conductance potassium channel complexed with calcium-calmodulin 0.7768 22 73
5z62-assembly1.cif.gz_C structure of human cytochrome c oxidase 0.776 15 70
5v03-assembly1.cif.gz_B a positive allosteric modulator binding pocket in sk2 ion channels is shared by riluzole and cyppa 0.7748 22 73
8h3f-assembly1.cif.gz_E cryo-em structure of the kbtbd2-crl3-csn complex 0.7724 22 75
ID Description Score Start End Superfamily
af_A0A0N7KNF8_52_165_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.8308 22 73 1.20.58.390
af_Q08BZ6_1_87_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.7945 22 74 1.20.58.80
3iqfL02 Special;Helix non-globular;Helix Hairpins; 0.7942 22 74 6.10.140.120
1u6iA02 Special;Helix non-globular;Helix Hairpins; 0.7939 22 74 6.10.140.120
3iqfC02 Special;Helix non-globular;Helix Hairpins; 0.7928 22 74 6.10.140.120
ID Description Score Start End GO Terms
AF-A0A7D5JC87-F1-model_v4 Uncharacterized protein 0.8004 22 83 GO:0016020
AF-A0A1Q3NCN6-F1-model_v4 deleted 0.7905 5 96
AF-Q5VB06-F1-model_v4 Cytochrome c oxidase subunit 3 0.7689 15 80 GO:0004129
GO:0005739
GO:0006123
GO:0016020
AF-A0A1Q3NCN6-F1-model_v4 deleted 0.7686 5 96
AF-A0A7Z0CZ99-F1-model_v4 deleted 0.7569 22 78

Feature Viewer

pLDDT pTM Quality
74.21 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map