F236147

General Info

Members Datasets Scaffolds Average Seq Length
161 117 161 137

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_101074095|Ga0070683_1010740952
Length 161
Sequence MPPSSKSSTKCSCHCCAADRHNHQVTTSAGYSGTPLHRKIGIKPDSRVLVSAAPPAFEIHDAPRSAVIHSRAAGASYDVILAFCPDVRRLRERFSRLAPRLTTAGALWIAWPKKSSGVATDLDENVVREIGLDQGLVDVKVIAIDETWSGLKFVRRLRDRG

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
64 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
65 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
66 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
84 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
85 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
93 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
103 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
104 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
105 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
106 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
107 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
108 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
109 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
110 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
111 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
112 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
113 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
114 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
115 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
116 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
117 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.89
Metatranscriptomes 3.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.11
Nodule 0
Rhizoplane 7.45
Rhizosphere 84.47
Stem 0
Stem Tuber 0
Unclassified 4.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10016949 3300003316 Bacteria 2891
2 Ga0070658_10000146 3300005327 Bacteria 62591
3 Ga0070658_10092250 3300005327 Bacteria 2497
4 Ga0070658_10239130 3300005327 Bacteria 1539
5 Ga0070658_10918148 3300005327 Bacteria 761
6 Ga0070683_100204756 3300005329 Unclassified 1874
7 Ga0070683_100887370 3300005329 Bacteria 855
8 Ga0070683_101074095 3300005329 Bacteria 773
9 Ga0070680_100001370 3300005336 Bacteria 17648
10 Ga0070680_100082091 3300005336 Bacteria 2660
11 Ga0070682_101953379 3300005337 Bacteria 515
12 Ga0068868_100736509 3300005338 Bacteria 885
13 Ga0070660_100037627 3300005339 Bacteria 3668
14 Ga0070660_100140161 3300005339 Bacteria 1940
15 Ga0070692_10018973 3300005345 Bacteria 3315
16 Ga0070668_100473845 3300005347 Bacteria 1080
17 Ga0070659_100000453 3300005366 Bacteria 30461
18 Ga0070659_100031227 3300005366 Bacteria 4125
19 Ga0070659_100879599 3300005366 Bacteria 782
20 Ga0070667_100000049 3300005367 Bacteria 158483
21 Ga0070663_100000512 3300005455 Bacteria 20499
22 Ga0070663_100159614 3300005455 Unclassified 1735
23 Ga0070662_100510695 3300005457 Bacteria 1003
24 Ga0070681_10000993 3300005458 Bacteria 24015
25 Ga0070681_10347354 3300005458 Bacteria 1394
26 Ga0070681_10568222 3300005458 Bacteria 1048
27 Ga0070679_100014840 3300005530 Bacteria 7484
28 Ga0070679_100034915 3300005530 Bacteria 4987
29 Ga0070679_100382514 3300005530 Bacteria 1354
30 Ga0070679_100655593 3300005530 Bacteria 992
31 Ga0070679_100893484 3300005530 Bacteria 832
32 Ga0070679_101587276 3300005530 Bacteria 602
33 Ga0070684_100349492 3300005535 Bacteria 1360
34 Ga0068853_100000503 3300005539 Bacteria 26688
35 Ga0070672_101179551 3300005543 Unclassified 682
36 Ga0070672_101599784 3300005543 Bacteria 585
37 Ga0070693_100658069 3300005547 Bacteria 762
38 Ga0070665_100393071 3300005548 Bacteria 1394
39 Ga0068864_100013245 3300005618 Bacteria 6830
40 Ga0068866_10549079 3300005718 Bacteria 772
41 Ga0068863_100288154 3300005841 Bacteria 1592
42 Ga0068858_100442941 3300005842 Bacteria 1251
43 Ga0075365_11122561 3300006038 Bacteria 553
44 Ga0075431_100256881 3300006847 Bacteria 1774
45 Ga0114129_10231201 3300009147 Bacteria 2490
46 Ga0105248_10000231 3300009177 Bacteria 64041
47 Ga0105237_10018854 3300009545 Bacteria 7136
48 Ga0105237_10056763 3300009545 Bacteria 3918
49 Ga0105249_10002941 3300009553 Bacteria 14702
50 Ga0105239_10731411 3300010375 Bacteria 1132
51 Ga0157373_10146270 3300013100 Unclassified 1662
52 Ga0157371_10026125 3300013102 Bacteria 4247
53 Ga0157370_10101681 3300013104 Bacteria 2692
54 Ga0157369_10043080 3300013105 Bacteria 4921
55 Ga0157374_10904066 3300013296 Unclassified 900
56 Ga0157372_11073594 3300013307 Unclassified 932
57 Ga0157372_11088657 3300013307 Bacteria 925
58 Ga0163163_10105992 3300014325 Bacteria 2836
59 Ga0163163_10221615 3300014325 Bacteria 1940
60 Ga0163163_11956071 3300014325 Bacteria 646
61 Ga0197907_10031296 3300020069 Bacteria 692
62 Ga0206353_10003954 3300020082 Bacteria 823
63 Ga0206353_11840558 3300020082 Bacteria 1512
64 Ga0224712_10331351 3300022467 Bacteria 717
65 Ga0207705_10000242 3300025909 Bacteria 53543
66 Ga0207705_10133623 3300025909 Bacteria 1848
67 Ga0207707_10001237 3300025912 Bacteria 23964
68 Ga0207707_10128571 3300025912 Bacteria 2215
69 Ga0207707_10329162 3300025912 Bacteria 1318
70 Ga0207671_10005017 3300025914 Bacteria 12382
71 Ga0207671_10071520 3300025914 Bacteria 2587
72 Ga0207660_10001330 3300025917 Bacteria 16529
73 Ga0207660_10334961 3300025917 Bacteria 1210
74 Ga0207657_10046393 3300025919 Bacteria 3806
75 Ga0207657_10067356 3300025919 Bacteria 3045
76 Ga0207657_10169647 3300025919 Bacteria 1769
77 Ga0207652_10001227 3300025921 Bacteria 22957
78 Ga0207652_10036055 3300025921 Bacteria 4179
79 Ga0207652_10376227 3300025921 Bacteria 1282
80 Ga0207652_10433578 3300025921 Bacteria 1185
81 Ga0207652_10581721 3300025921 Bacteria 1005
82 Ga0207652_11176898 3300025921 Unclassified 668
83 Ga0207690_10000113 3300025932 Bacteria 66612
84 Ga0207690_10110132 3300025932 Bacteria 1982
85 Ga0207690_10472551 3300025932 Bacteria 1011
86 Ga0207665_11475248 3300025939 Bacteria 541
87 Ga0207711_10005397 3300025941 Bacteria 10810
88 Ga0207661_10219660 3300025944 Unclassified 1679
89 Ga0207712_10005700 3300025961 Bacteria 7850
90 Ga0207658_10000033 3300025986 Bacteria 158540
91 Ga0207703_10407626 3300026035 Bacteria 1262
92 Ga0207639_10015997 3300026041 Bacteria 5298
93 Ga0207678_10000140 3300026067 Bacteria 59288
94 Ga0207678_10587156 3300026067 Bacteria 976
95 Ga0207641_10471917 3300026088 Bacteria 1215
96 Ga0207648_11122574 3300026089 Bacteria 738
97 Ga0207676_10069152 3300026095 Bacteria 2827
98 Ga0207675_100291590 3300026118 Bacteria 1587
99 Ga0207675_100936920 3300026118 Unclassified 883
100 Ga0207698_10205161 3300026142 Bacteria 1769
101 Ga0268266_10081980 3300028379 Bacteria 2813
102 Ga0265337_1020885 3300028556 Bacteria 2047
103 Ga0265319_1004864 3300028563 Bacteria 6570
104 Ga0265318_10009783 3300028577 Bacteria 4202
105 Ga0265323_10100834 3300028653 Bacteria 956
106 Ga0265338_10026230 3300028800 Bacteria 5885
107 Ga0265338_10585821 3300028800 Bacteria 778
108 Ga0265320_10011368 3300031240 Bacteria 5243
109 Ga0265325_10183056 3300031241 Bacteria 975
110 Ga0265339_10109787 3300031249 Bacteria 1428
111 Ga0307408_100309782 3300031548 Bacteria 1326
112 Ga0265313_10283297 3300031595 Bacteria 669
113 Ga0265314_10023909 3300031711 Bacteria 4645
114 Ga0307409_100003416 3300031995 Bacteria 8627
115 Ga0307416_100016353 3300032002 Bacteria 5154
116 Ga0307414_10470048 3300032004 Unclassified 1107
117 Ga0307415_100229604 3300032126 Bacteria 1494
118 Ga0307507_10006395 3300033179 Bacteria 18125
119 Ga0395900_1819058 3300037418 Bacteria 520
120 Ga0395898_0201392 3300037466 Bacteria 1900
121 Ga0395901_0422336 3300038443 Bacteria 1367
122 Ga0436365_0169348 3300039437 Bacteria 1028
123 Ga0436363_1573716 3300039450 Bacteria 605
124 Ga0436362_0864311 3300039453 Bacteria 624
125 Ga0451793_1268448 3300041452 Bacteria 1249
126 Ga0466969_0512776 3300044656 Bacteria 548
127 Ga0466961_0045664 3300044693 Bacteria 2803
128 Ga0466963_0208033 3300044694 Bacteria 1369
129 Ga0466964_0883489 3300044706 Bacteria 510
130 Ga0466970_0600366 3300044765 Bacteria 638
131 Ga0466967_0140372 3300045976 Bacteria 2250
132 Ga0466967_0251765 3300045976 Bacteria 1687
133 Ga0466967_1335664 3300045976 Bacteria 714
134 Ga0495686_0003267 3300047472 Bacteria 14189
135 Ga0496102_0069915 3300048905 Unclassified 3223
136 Ga0496104_0190389 3300048907 Bacteria 1963
137 Ga0496105_0313841 3300048908 Bacteria 1258
138 Ga0496108_1564453 3300048911 Bacteria 547
139 Ga0496109_0202004 3300048912 Bacteria 1869
140 Ga0496112_0019142 3300048915 Bacteria 6455
141 Ga0496112_0037108 3300048915 Bacteria 4757
142 Ga0496112_0736868 3300048915 Bacteria 912
143 Ga0496113_0057262 3300048916 Bacteria 2929
144 Ga0496114_0796668 3300048917 Bacteria 824
145 Ga0496115_0356764 3300048918 Bacteria 1192
146 Ga0496118_0191634 3300048921 Bacteria 1222
147 Ga0496121_0125367 3300048924 Bacteria 1932
148 Ga0496122_0000362 3300048925 Bacteria 97690
149 Ga0496123_0000317 3300048926 Bacteria 92079
150 Ga0501214_044495 3300049659 Bacteria 656
151 Ga0501259_007430 3300049688 Bacteria 1754
152 Ga0501262_036935 3300049759 Unclassified 719
153 Ga0501267_007168 3300049764 Bacteria 1081
154 Ga0501278_010689 3300049774 Unclassified 736
155 nmdc:mga0yw44_359955_c1 3300050492 Bacteria 980
156 Ga0495612_0401677 3300053078 Bacteria 623
157 Ga0495619_0774963 3300053085 Bacteria 650
158 Ga0500643_002065 3300053087 Bacteria 10710
159 Ga0500597_000058 3300053120 Bacteria 22169
160 Ga0500620_051258 3300053155 Bacteria 1384
161 Ga0587071_082908 3300060344 Bacteria 717

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028556 Ga0265337_1020885 Ga0265337_10208851 125
2 3300028563 Ga0265319_1004864 Ga0265319_10048645 125
3 3300028577 Ga0265318_10009783 Ga0265318_100097832 125
4 3300028653 Ga0265323_10100834 Ga0265323_101008342 125
5 3300028800 Ga0265338_10026230 Ga0265338_100262305 125
6 3300028800 Ga0265338_10585821 Ga0265338_105858212 125
7 3300031240 Ga0265320_10011368 Ga0265320_100113685 125
8 3300031241 Ga0265325_10183056 Ga0265325_101830562 125
9 3300031249 Ga0265339_10109787 Ga0265339_101097872 125
10 3300031595 Ga0265313_10283297 Ga0265313_102832972 125
11 3300031711 Ga0265314_10023909 Ga0265314_100239094 125
12 3300048915 Ga0496112_0736868 Ga0496112_0736868_11_436 126
13 3300053085 Ga0495619_0774963 Ga0495619_0774963_188_604 126
14 3300005455 Ga0070663_100159614 Ga0070663_1001596142 127
15 3300005535 Ga0070684_100349492 Ga0070684_1003494921 127
16 3300005543 Ga0070672_101179551 Ga0070672_1011795512 127
17 3300006038 Ga0075365_11122561 Ga0075365_111225611 127
18 3300025939 Ga0207665_11475248 Ga0207665_114752481 127
19 3300026067 Ga0207678_10587156 Ga0207678_105871561 127
20 3300026118 Ga0207675_100936920 Ga0207675_1009369201 127
21 3300033179 Ga0307507_10006395 Ga0307507_1000639511 127
22 3300044694 Ga0466963_0208033 Ga0466963_0208033_553_951 127
23 3300048912 Ga0496109_0202004 Ga0496109_0202004_1283_1675 127
24 3300048917 Ga0496114_0796668 Ga0496114_0796668_131_520 127
25 3300048918 Ga0496115_0356764 Ga0496115_0356764_486_878 127
26 3300050492 nmdc:mga0yw44_359955_c1 nmdc:mga0yw44_359955_c1_323_754 127
27 3300053155 Ga0500620_051258 Ga0500620_051258_401_799 127
28 3300005329 Ga0070683_100887370 Ga0070683_1008873702 128
29 3300006847 Ga0075431_100256881 Ga0075431_1002568811 128
30 3300013296 Ga0157374_10904066 Ga0157374_109040661 128
31 3300014325 Ga0163163_11956071 Ga0163163_119560712 128
32 3300044706 Ga0466964_0883489 Ga0466964_0883489_50_487 128
33 3300045976 Ga0466967_0251765 Ga0466967_0251765_544_960 128
34 3300053078 Ga0495612_0401677 Ga0495612_0401677_185_580 128
35 3300005327 Ga0070658_10000146 Ga0070658_1000014651 129
36 3300005327 Ga0070658_10092250 Ga0070658_100922505 129
37 3300005327 Ga0070658_10239130 Ga0070658_102391302 129
38 3300005327 Ga0070658_10918148 Ga0070658_109181482 129
39 3300005329 Ga0070683_100204756 Ga0070683_1002047563 129
40 3300005336 Ga0070680_100001370 Ga0070680_1000013701 129
41 3300005336 Ga0070680_100082091 Ga0070680_1000820912 129
42 3300005338 Ga0068868_100736509 Ga0068868_1007365092 129
43 3300005339 Ga0070660_100037627 Ga0070660_1000376272 129
44 3300005339 Ga0070660_100140161 Ga0070660_1001401613 129
45 3300005345 Ga0070692_10018973 Ga0070692_100189733 129
46 3300005347 Ga0070668_100473845 Ga0070668_1004738452 129
47 3300005366 Ga0070659_100000453 Ga0070659_10000045325 129
48 3300005366 Ga0070659_100031227 Ga0070659_1000312273 129
49 3300005458 Ga0070681_10000993 Ga0070681_100009936 129
50 3300005458 Ga0070681_10347354 Ga0070681_103473542 129
51 3300005458 Ga0070681_10568222 Ga0070681_105682222 129
52 3300005530 Ga0070679_100014840 Ga0070679_1000148406 129
53 3300005530 Ga0070679_100034915 Ga0070679_1000349157 129
54 3300005530 Ga0070679_100382514 Ga0070679_1003825142 129
55 3300005530 Ga0070679_100893484 Ga0070679_1008934842 129
56 3300005530 Ga0070679_101587276 Ga0070679_1015872761 129
57 3300005543 Ga0070672_101599784 Ga0070672_1015997841 129
58 3300005548 Ga0070665_100393071 Ga0070665_1003930712 129
59 3300005618 Ga0068864_100013245 Ga0068864_1000132453 129
60 3300005718 Ga0068866_10549079 Ga0068866_105490791 129
61 3300009147 Ga0114129_10231201 Ga0114129_102312014 129
62 3300009545 Ga0105237_10056763 Ga0105237_100567632 129
63 3300013100 Ga0157373_10146270 Ga0157373_101462702 129
64 3300013102 Ga0157371_10026125 Ga0157371_100261253 129
65 3300013104 Ga0157370_10101681 Ga0157370_101016813 129
66 3300013105 Ga0157369_10043080 Ga0157369_100430803 129
67 3300013307 Ga0157372_11088657 Ga0157372_110886572 129
68 3300014325 Ga0163163_10105992 Ga0163163_101059921 129
69 3300014325 Ga0163163_10221615 Ga0163163_102216151 129
70 3300020069 Ga0197907_10031296 Ga0197907_100312961 129
71 3300020082 Ga0206353_11840558 Ga0206353_118405582 129
72 3300022467 Ga0224712_10331351 Ga0224712_103313512 129
73 3300025909 Ga0207705_10000242 Ga0207705_1000024219 129
74 3300025909 Ga0207705_10133623 Ga0207705_101336232 129
75 3300025912 Ga0207707_10001237 Ga0207707_1000123717 129
76 3300025912 Ga0207707_10128571 Ga0207707_101285713 129
77 3300025912 Ga0207707_10329162 Ga0207707_103291622 129
78 3300025914 Ga0207671_10071520 Ga0207671_100715203 129
79 3300025917 Ga0207660_10001330 Ga0207660_100013308 129
80 3300025917 Ga0207660_10334961 Ga0207660_103349612 129
81 3300025919 Ga0207657_10046393 Ga0207657_100463932 129
82 3300025919 Ga0207657_10067356 Ga0207657_100673562 129
83 3300025919 Ga0207657_10169647 Ga0207657_101696474 129
84 3300025921 Ga0207652_10001227 Ga0207652_1000122717 129
85 3300025921 Ga0207652_10036055 Ga0207652_100360556 129
86 3300025921 Ga0207652_10376227 Ga0207652_103762272 129
87 3300025921 Ga0207652_10581721 Ga0207652_105817212 129
88 3300025921 Ga0207652_11176898 Ga0207652_111768982 129
89 3300025932 Ga0207690_10000113 Ga0207690_100001133 129
90 3300025932 Ga0207690_10110132 Ga0207690_101101322 129
91 3300025944 Ga0207661_10219660 Ga0207661_102196603 129
92 3300026089 Ga0207648_11122574 Ga0207648_111225741 129
93 3300026095 Ga0207676_10069152 Ga0207676_100691522 129
94 3300026118 Ga0207675_100291590 Ga0207675_1002915902 129
95 3300028379 Ga0268266_10081980 Ga0268266_100819803 129
96 3300037418 Ga0395900_1819058 Ga0395900_1819058_100_510 129
97 3300037466 Ga0395898_0201392 Ga0395898_0201392_541_951 129
98 3300038443 Ga0395901_0422336 Ga0395901_0422336_10_420 129
99 3300039437 Ga0436365_0169348 Ga0436365_0169348_274_681 129
100 3300039450 Ga0436363_1573716 Ga0436363_1573716_46_453 129
101 3300039453 Ga0436362_0864311 Ga0436362_0864311_99_506 129
102 3300044656 Ga0466969_0512776 Ga0466969_0512776_93_509 129
103 3300044693 Ga0466961_0045664 Ga0466961_0045664_1102_1524 129
104 3300044765 Ga0466970_0600366 Ga0466970_0600366_39_452 129
105 3300045976 Ga0466967_1335664 Ga0466967_1335664_15_419 129
106 3300048907 Ga0496104_0190389 Ga0496104_0190389_1349_1750 129
107 3300048908 Ga0496105_0313841 Ga0496105_0313841_702_1103 129
108 3300048915 Ga0496112_0019142 Ga0496112_0019142_3759_4160 129
109 3300048915 Ga0496112_0037108 Ga0496112_0037108_3984_4385 129
110 3300048916 Ga0496113_0057262 Ga0496113_0057262_334_735 129
111 3300049659 Ga0501214_044495 Ga0501214_044495_136_558 129
112 3300005329 Ga0070683_101074095 Ga0070683_1010740952 130
113 3300005337 Ga0070682_101953379 Ga0070682_1019533791 130
114 3300005366 Ga0070659_100879599 Ga0070659_1008795991 130
115 3300005367 Ga0070667_100000049 Ga0070667_100000049121 130
116 3300005455 Ga0070663_100000512 Ga0070663_10000051216 130
117 3300005457 Ga0070662_100510695 Ga0070662_1005106952 130
118 3300005539 Ga0068853_100000503 Ga0068853_10000050322 130
119 3300005547 Ga0070693_100658069 Ga0070693_1006580691 130
120 3300005841 Ga0068863_100288154 Ga0068863_1002881542 130
121 3300005842 Ga0068858_100442941 Ga0068858_1004429412 130
122 3300009177 Ga0105248_10000231 Ga0105248_1000023129 130
123 3300009545 Ga0105237_10018854 Ga0105237_100188546 130
124 3300009553 Ga0105249_10002941 Ga0105249_100029419 130
125 3300010375 Ga0105239_10731411 Ga0105239_107314112 130
126 3300013307 Ga0157372_11073594 Ga0157372_110735942 130
127 3300025914 Ga0207671_10005017 Ga0207671_1000501715 130
128 3300025932 Ga0207690_10472551 Ga0207690_104725511 130
129 3300025941 Ga0207711_10005397 Ga0207711_1000539712 130
130 3300025961 Ga0207712_10005700 Ga0207712_100057009 130
131 3300025986 Ga0207658_10000033 Ga0207658_1000003331 130
132 3300026035 Ga0207703_10407626 Ga0207703_104076262 130
133 3300026041 Ga0207639_10015997 Ga0207639_100159973 130
134 3300026067 Ga0207678_10000140 Ga0207678_1000014021 130
135 3300026088 Ga0207641_10471917 Ga0207641_104719172 130
136 3300026142 Ga0207698_10205161 Ga0207698_102051612 130
137 3300031548 Ga0307408_100309782 Ga0307408_1003097822 130
138 3300031995 Ga0307409_100003416 Ga0307409_1000034165 130
139 3300032002 Ga0307416_100016353 Ga0307416_1000163534 130
140 3300032004 Ga0307414_10470048 Ga0307414_104700482 130
141 3300032126 Ga0307415_100229604 Ga0307415_1002296042 130
142 3300041452 Ga0451793_1268448 Ga0451793_1268448_796_1224 130
143 3300045976 Ga0466967_0140372 Ga0466967_0140372_1392_1814 130
144 3300047472 Ga0495686_0003267 Ga0495686_0003267_5036_5464 130
145 3300048905 Ga0496102_0069915 Ga0496102_0069915_2420_2836 130
146 3300048921 Ga0496118_0191634 Ga0496118_0191634_708_1136 130
147 3300048924 Ga0496121_0125367 Ga0496121_0125367_37_465 130
148 3300048925 Ga0496122_0000362 Ga0496122_0000362_21989_22417 130
149 3300048926 Ga0496123_0000317 Ga0496123_0000317_64657_65085 130
150 3300049688 Ga0501259_007430 Ga0501259_007430_26_448 130
151 3300049759 Ga0501262_036935 Ga0501262_036935_27_449 130
152 3300049764 Ga0501267_007168 Ga0501267_007168_603_1025 130
153 3300049774 Ga0501278_010689 Ga0501278_010689_140_562 130
154 3300053087 Ga0500643_002065 Ga0500643_002065_2049_2477 130
155 3300053120 Ga0500597_000058 Ga0500597_000058_4726_5154 130
156 3300060344 Ga0587071_082908 Ga0587071_082908_247_663 130
157 3300003316 rootH1_10016949 rootH1_100169493 131
158 3300005530 Ga0070679_100655593 Ga0070679_1006555931 131
159 3300020082 Ga0206353_10003954 Ga0206353_100039541 131
160 3300025921 Ga0207652_10433578 Ga0207652_104335781 131
161 3300048911 Ga0496108_1564453 Ga0496108_1564453_55_480 131

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nxn-assembly1.cif.gz_A t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11 0.7413 44 122
3cjt-assembly4.cif.gz_G ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.7399 44 122
3i58-assembly1.cif.gz_A crystal structure of an o-methyltransferase (ncsb1) from neocarzinostatin biosynthesis in complex with s-adenosyl-l-homocysteine (sah) and 2-hydroxy-7-methoxy-5-methyl naphthoic acid (na) 0.7347 40 125
4e2x-assembly1.cif.gz_A x-ray structure of the y222f mutant of tcab9, a c-3'-methyltransferase, in complex with s-adenosyl-l-homocysteine and dtdp 0.731 42 127
3i5u-assembly1.cif.gz_A crystal structure of an o-methyltransferase (ncsb1) from neocarzinostatin biosynthesis in complex with s-adenosylmethionine (sam) and 2-hydroxy-5-methyl naphthoic acid (mna) 0.7298 40 125
ID Description Score Start End Superfamily
af_P9WLG9_29_152_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.825 11 125 3.40.50.150
af_P9WLG9_29_152_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7643 11 125 3.40.50.150
af_A0A0R0KAP7_457_568_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7447 75 122 3.30.70.240
af_P9WK97_418_527_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7205 77 126 3.30.70.240
af_Q58170_72_142_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.7188 48 122 3.30.110.40
ID Description Score Start End GO Terms
AF-A0A2A5DFH1-F1-model_v4 DUF3052 domain-containing protein 0.9743 50 125
AF-A0A386Z7P1-F1-model_v4 DUF3052 domain-containing protein 0.971 1 129
AF-A0A2N1FAY2-F1-model_v4 DUF3052 domain-containing protein 0.9705 46 129
AF-A0A6V8KPI8-F1-model_v4 DUF3052 domain-containing protein 0.9625 52 131
AF-A0A538EFP1-F1-model_v4 DUF3052 domain-containing protein 0.96 64 129

Feature Viewer

pLDDT pTM Quality
92.47 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map