F236147
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 161 | 117 | 161 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_101074095|Ga0070683_1010740952 |
| Length | 161 |
| Sequence | MPPSSKSSTKCSCHCCAADRHNHQVTTSAGYSGTPLHRKIGIKPDSRVLVSAAPPAFEIHDAPRSAVIHSRAAGASYDVILAFCPDVRRLRERFSRLAPRLTTAGALWIAWPKKSSGVATDLDENVVREIGLDQGLVDVKVIAIDETWSGLKFVRRLRDRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 18 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 22 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 23 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 24 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 25 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 26 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 27 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 40 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 41 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 42 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 64 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 65 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 66 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 67 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 68 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 69 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 70 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 71 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 72 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 73 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 74 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 75 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 76 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 77 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 78 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 79 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 80 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 81 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 82 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 83 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 84 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 85 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 86 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 87 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 88 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 89 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 90 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 91 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 92 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 94 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 95 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 96 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 97 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 98 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 99 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 100 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 101 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 102 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 103 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 104 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 105 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 106 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 107 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 108 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 109 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 110 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 111 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 112 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 115 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 116 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 117 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.89 |
| Metatranscriptomes | 3.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.11 |
| Nodule | 0 |
| Rhizoplane | 7.45 |
| Rhizosphere | 84.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10016949 | 3300003316 | Bacteria | 2891 |
| 2 | Ga0070658_10000146 | 3300005327 | Bacteria | 62591 |
| 3 | Ga0070658_10092250 | 3300005327 | Bacteria | 2497 |
| 4 | Ga0070658_10239130 | 3300005327 | Bacteria | 1539 |
| 5 | Ga0070658_10918148 | 3300005327 | Bacteria | 761 |
| 6 | Ga0070683_100204756 | 3300005329 | Unclassified | 1874 |
| 7 | Ga0070683_100887370 | 3300005329 | Bacteria | 855 |
| 8 | Ga0070683_101074095 | 3300005329 | Bacteria | 773 |
| 9 | Ga0070680_100001370 | 3300005336 | Bacteria | 17648 |
| 10 | Ga0070680_100082091 | 3300005336 | Bacteria | 2660 |
| 11 | Ga0070682_101953379 | 3300005337 | Bacteria | 515 |
| 12 | Ga0068868_100736509 | 3300005338 | Bacteria | 885 |
| 13 | Ga0070660_100037627 | 3300005339 | Bacteria | 3668 |
| 14 | Ga0070660_100140161 | 3300005339 | Bacteria | 1940 |
| 15 | Ga0070692_10018973 | 3300005345 | Bacteria | 3315 |
| 16 | Ga0070668_100473845 | 3300005347 | Bacteria | 1080 |
| 17 | Ga0070659_100000453 | 3300005366 | Bacteria | 30461 |
| 18 | Ga0070659_100031227 | 3300005366 | Bacteria | 4125 |
| 19 | Ga0070659_100879599 | 3300005366 | Bacteria | 782 |
| 20 | Ga0070667_100000049 | 3300005367 | Bacteria | 158483 |
| 21 | Ga0070663_100000512 | 3300005455 | Bacteria | 20499 |
| 22 | Ga0070663_100159614 | 3300005455 | Unclassified | 1735 |
| 23 | Ga0070662_100510695 | 3300005457 | Bacteria | 1003 |
| 24 | Ga0070681_10000993 | 3300005458 | Bacteria | 24015 |
| 25 | Ga0070681_10347354 | 3300005458 | Bacteria | 1394 |
| 26 | Ga0070681_10568222 | 3300005458 | Bacteria | 1048 |
| 27 | Ga0070679_100014840 | 3300005530 | Bacteria | 7484 |
| 28 | Ga0070679_100034915 | 3300005530 | Bacteria | 4987 |
| 29 | Ga0070679_100382514 | 3300005530 | Bacteria | 1354 |
| 30 | Ga0070679_100655593 | 3300005530 | Bacteria | 992 |
| 31 | Ga0070679_100893484 | 3300005530 | Bacteria | 832 |
| 32 | Ga0070679_101587276 | 3300005530 | Bacteria | 602 |
| 33 | Ga0070684_100349492 | 3300005535 | Bacteria | 1360 |
| 34 | Ga0068853_100000503 | 3300005539 | Bacteria | 26688 |
| 35 | Ga0070672_101179551 | 3300005543 | Unclassified | 682 |
| 36 | Ga0070672_101599784 | 3300005543 | Bacteria | 585 |
| 37 | Ga0070693_100658069 | 3300005547 | Bacteria | 762 |
| 38 | Ga0070665_100393071 | 3300005548 | Bacteria | 1394 |
| 39 | Ga0068864_100013245 | 3300005618 | Bacteria | 6830 |
| 40 | Ga0068866_10549079 | 3300005718 | Bacteria | 772 |
| 41 | Ga0068863_100288154 | 3300005841 | Bacteria | 1592 |
| 42 | Ga0068858_100442941 | 3300005842 | Bacteria | 1251 |
| 43 | Ga0075365_11122561 | 3300006038 | Bacteria | 553 |
| 44 | Ga0075431_100256881 | 3300006847 | Bacteria | 1774 |
| 45 | Ga0114129_10231201 | 3300009147 | Bacteria | 2490 |
| 46 | Ga0105248_10000231 | 3300009177 | Bacteria | 64041 |
| 47 | Ga0105237_10018854 | 3300009545 | Bacteria | 7136 |
| 48 | Ga0105237_10056763 | 3300009545 | Bacteria | 3918 |
| 49 | Ga0105249_10002941 | 3300009553 | Bacteria | 14702 |
| 50 | Ga0105239_10731411 | 3300010375 | Bacteria | 1132 |
| 51 | Ga0157373_10146270 | 3300013100 | Unclassified | 1662 |
| 52 | Ga0157371_10026125 | 3300013102 | Bacteria | 4247 |
| 53 | Ga0157370_10101681 | 3300013104 | Bacteria | 2692 |
| 54 | Ga0157369_10043080 | 3300013105 | Bacteria | 4921 |
| 55 | Ga0157374_10904066 | 3300013296 | Unclassified | 900 |
| 56 | Ga0157372_11073594 | 3300013307 | Unclassified | 932 |
| 57 | Ga0157372_11088657 | 3300013307 | Bacteria | 925 |
| 58 | Ga0163163_10105992 | 3300014325 | Bacteria | 2836 |
| 59 | Ga0163163_10221615 | 3300014325 | Bacteria | 1940 |
| 60 | Ga0163163_11956071 | 3300014325 | Bacteria | 646 |
| 61 | Ga0197907_10031296 | 3300020069 | Bacteria | 692 |
| 62 | Ga0206353_10003954 | 3300020082 | Bacteria | 823 |
| 63 | Ga0206353_11840558 | 3300020082 | Bacteria | 1512 |
| 64 | Ga0224712_10331351 | 3300022467 | Bacteria | 717 |
| 65 | Ga0207705_10000242 | 3300025909 | Bacteria | 53543 |
| 66 | Ga0207705_10133623 | 3300025909 | Bacteria | 1848 |
| 67 | Ga0207707_10001237 | 3300025912 | Bacteria | 23964 |
| 68 | Ga0207707_10128571 | 3300025912 | Bacteria | 2215 |
| 69 | Ga0207707_10329162 | 3300025912 | Bacteria | 1318 |
| 70 | Ga0207671_10005017 | 3300025914 | Bacteria | 12382 |
| 71 | Ga0207671_10071520 | 3300025914 | Bacteria | 2587 |
| 72 | Ga0207660_10001330 | 3300025917 | Bacteria | 16529 |
| 73 | Ga0207660_10334961 | 3300025917 | Bacteria | 1210 |
| 74 | Ga0207657_10046393 | 3300025919 | Bacteria | 3806 |
| 75 | Ga0207657_10067356 | 3300025919 | Bacteria | 3045 |
| 76 | Ga0207657_10169647 | 3300025919 | Bacteria | 1769 |
| 77 | Ga0207652_10001227 | 3300025921 | Bacteria | 22957 |
| 78 | Ga0207652_10036055 | 3300025921 | Bacteria | 4179 |
| 79 | Ga0207652_10376227 | 3300025921 | Bacteria | 1282 |
| 80 | Ga0207652_10433578 | 3300025921 | Bacteria | 1185 |
| 81 | Ga0207652_10581721 | 3300025921 | Bacteria | 1005 |
| 82 | Ga0207652_11176898 | 3300025921 | Unclassified | 668 |
| 83 | Ga0207690_10000113 | 3300025932 | Bacteria | 66612 |
| 84 | Ga0207690_10110132 | 3300025932 | Bacteria | 1982 |
| 85 | Ga0207690_10472551 | 3300025932 | Bacteria | 1011 |
| 86 | Ga0207665_11475248 | 3300025939 | Bacteria | 541 |
| 87 | Ga0207711_10005397 | 3300025941 | Bacteria | 10810 |
| 88 | Ga0207661_10219660 | 3300025944 | Unclassified | 1679 |
| 89 | Ga0207712_10005700 | 3300025961 | Bacteria | 7850 |
| 90 | Ga0207658_10000033 | 3300025986 | Bacteria | 158540 |
| 91 | Ga0207703_10407626 | 3300026035 | Bacteria | 1262 |
| 92 | Ga0207639_10015997 | 3300026041 | Bacteria | 5298 |
| 93 | Ga0207678_10000140 | 3300026067 | Bacteria | 59288 |
| 94 | Ga0207678_10587156 | 3300026067 | Bacteria | 976 |
| 95 | Ga0207641_10471917 | 3300026088 | Bacteria | 1215 |
| 96 | Ga0207648_11122574 | 3300026089 | Bacteria | 738 |
| 97 | Ga0207676_10069152 | 3300026095 | Bacteria | 2827 |
| 98 | Ga0207675_100291590 | 3300026118 | Bacteria | 1587 |
| 99 | Ga0207675_100936920 | 3300026118 | Unclassified | 883 |
| 100 | Ga0207698_10205161 | 3300026142 | Bacteria | 1769 |
| 101 | Ga0268266_10081980 | 3300028379 | Bacteria | 2813 |
| 102 | Ga0265337_1020885 | 3300028556 | Bacteria | 2047 |
| 103 | Ga0265319_1004864 | 3300028563 | Bacteria | 6570 |
| 104 | Ga0265318_10009783 | 3300028577 | Bacteria | 4202 |
| 105 | Ga0265323_10100834 | 3300028653 | Bacteria | 956 |
| 106 | Ga0265338_10026230 | 3300028800 | Bacteria | 5885 |
| 107 | Ga0265338_10585821 | 3300028800 | Bacteria | 778 |
| 108 | Ga0265320_10011368 | 3300031240 | Bacteria | 5243 |
| 109 | Ga0265325_10183056 | 3300031241 | Bacteria | 975 |
| 110 | Ga0265339_10109787 | 3300031249 | Bacteria | 1428 |
| 111 | Ga0307408_100309782 | 3300031548 | Bacteria | 1326 |
| 112 | Ga0265313_10283297 | 3300031595 | Bacteria | 669 |
| 113 | Ga0265314_10023909 | 3300031711 | Bacteria | 4645 |
| 114 | Ga0307409_100003416 | 3300031995 | Bacteria | 8627 |
| 115 | Ga0307416_100016353 | 3300032002 | Bacteria | 5154 |
| 116 | Ga0307414_10470048 | 3300032004 | Unclassified | 1107 |
| 117 | Ga0307415_100229604 | 3300032126 | Bacteria | 1494 |
| 118 | Ga0307507_10006395 | 3300033179 | Bacteria | 18125 |
| 119 | Ga0395900_1819058 | 3300037418 | Bacteria | 520 |
| 120 | Ga0395898_0201392 | 3300037466 | Bacteria | 1900 |
| 121 | Ga0395901_0422336 | 3300038443 | Bacteria | 1367 |
| 122 | Ga0436365_0169348 | 3300039437 | Bacteria | 1028 |
| 123 | Ga0436363_1573716 | 3300039450 | Bacteria | 605 |
| 124 | Ga0436362_0864311 | 3300039453 | Bacteria | 624 |
| 125 | Ga0451793_1268448 | 3300041452 | Bacteria | 1249 |
| 126 | Ga0466969_0512776 | 3300044656 | Bacteria | 548 |
| 127 | Ga0466961_0045664 | 3300044693 | Bacteria | 2803 |
| 128 | Ga0466963_0208033 | 3300044694 | Bacteria | 1369 |
| 129 | Ga0466964_0883489 | 3300044706 | Bacteria | 510 |
| 130 | Ga0466970_0600366 | 3300044765 | Bacteria | 638 |
| 131 | Ga0466967_0140372 | 3300045976 | Bacteria | 2250 |
| 132 | Ga0466967_0251765 | 3300045976 | Bacteria | 1687 |
| 133 | Ga0466967_1335664 | 3300045976 | Bacteria | 714 |
| 134 | Ga0495686_0003267 | 3300047472 | Bacteria | 14189 |
| 135 | Ga0496102_0069915 | 3300048905 | Unclassified | 3223 |
| 136 | Ga0496104_0190389 | 3300048907 | Bacteria | 1963 |
| 137 | Ga0496105_0313841 | 3300048908 | Bacteria | 1258 |
| 138 | Ga0496108_1564453 | 3300048911 | Bacteria | 547 |
| 139 | Ga0496109_0202004 | 3300048912 | Bacteria | 1869 |
| 140 | Ga0496112_0019142 | 3300048915 | Bacteria | 6455 |
| 141 | Ga0496112_0037108 | 3300048915 | Bacteria | 4757 |
| 142 | Ga0496112_0736868 | 3300048915 | Bacteria | 912 |
| 143 | Ga0496113_0057262 | 3300048916 | Bacteria | 2929 |
| 144 | Ga0496114_0796668 | 3300048917 | Bacteria | 824 |
| 145 | Ga0496115_0356764 | 3300048918 | Bacteria | 1192 |
| 146 | Ga0496118_0191634 | 3300048921 | Bacteria | 1222 |
| 147 | Ga0496121_0125367 | 3300048924 | Bacteria | 1932 |
| 148 | Ga0496122_0000362 | 3300048925 | Bacteria | 97690 |
| 149 | Ga0496123_0000317 | 3300048926 | Bacteria | 92079 |
| 150 | Ga0501214_044495 | 3300049659 | Bacteria | 656 |
| 151 | Ga0501259_007430 | 3300049688 | Bacteria | 1754 |
| 152 | Ga0501262_036935 | 3300049759 | Unclassified | 719 |
| 153 | Ga0501267_007168 | 3300049764 | Bacteria | 1081 |
| 154 | Ga0501278_010689 | 3300049774 | Unclassified | 736 |
| 155 | nmdc:mga0yw44_359955_c1 | 3300050492 | Bacteria | 980 |
| 156 | Ga0495612_0401677 | 3300053078 | Bacteria | 623 |
| 157 | Ga0495619_0774963 | 3300053085 | Bacteria | 650 |
| 158 | Ga0500643_002065 | 3300053087 | Bacteria | 10710 |
| 159 | Ga0500597_000058 | 3300053120 | Bacteria | 22169 |
| 160 | Ga0500620_051258 | 3300053155 | Bacteria | 1384 |
| 161 | Ga0587071_082908 | 3300060344 | Bacteria | 717 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028556 | Ga0265337_1020885 | Ga0265337_10208851 | 125 |
| 2 | 3300028563 | Ga0265319_1004864 | Ga0265319_10048645 | 125 |
| 3 | 3300028577 | Ga0265318_10009783 | Ga0265318_100097832 | 125 |
| 4 | 3300028653 | Ga0265323_10100834 | Ga0265323_101008342 | 125 |
| 5 | 3300028800 | Ga0265338_10026230 | Ga0265338_100262305 | 125 |
| 6 | 3300028800 | Ga0265338_10585821 | Ga0265338_105858212 | 125 |
| 7 | 3300031240 | Ga0265320_10011368 | Ga0265320_100113685 | 125 |
| 8 | 3300031241 | Ga0265325_10183056 | Ga0265325_101830562 | 125 |
| 9 | 3300031249 | Ga0265339_10109787 | Ga0265339_101097872 | 125 |
| 10 | 3300031595 | Ga0265313_10283297 | Ga0265313_102832972 | 125 |
| 11 | 3300031711 | Ga0265314_10023909 | Ga0265314_100239094 | 125 |
| 12 | 3300048915 | Ga0496112_0736868 | Ga0496112_0736868_11_436 | 126 |
| 13 | 3300053085 | Ga0495619_0774963 | Ga0495619_0774963_188_604 | 126 |
| 14 | 3300005455 | Ga0070663_100159614 | Ga0070663_1001596142 | 127 |
| 15 | 3300005535 | Ga0070684_100349492 | Ga0070684_1003494921 | 127 |
| 16 | 3300005543 | Ga0070672_101179551 | Ga0070672_1011795512 | 127 |
| 17 | 3300006038 | Ga0075365_11122561 | Ga0075365_111225611 | 127 |
| 18 | 3300025939 | Ga0207665_11475248 | Ga0207665_114752481 | 127 |
| 19 | 3300026067 | Ga0207678_10587156 | Ga0207678_105871561 | 127 |
| 20 | 3300026118 | Ga0207675_100936920 | Ga0207675_1009369201 | 127 |
| 21 | 3300033179 | Ga0307507_10006395 | Ga0307507_1000639511 | 127 |
| 22 | 3300044694 | Ga0466963_0208033 | Ga0466963_0208033_553_951 | 127 |
| 23 | 3300048912 | Ga0496109_0202004 | Ga0496109_0202004_1283_1675 | 127 |
| 24 | 3300048917 | Ga0496114_0796668 | Ga0496114_0796668_131_520 | 127 |
| 25 | 3300048918 | Ga0496115_0356764 | Ga0496115_0356764_486_878 | 127 |
| 26 | 3300050492 | nmdc:mga0yw44_359955_c1 | nmdc:mga0yw44_359955_c1_323_754 | 127 |
| 27 | 3300053155 | Ga0500620_051258 | Ga0500620_051258_401_799 | 127 |
| 28 | 3300005329 | Ga0070683_100887370 | Ga0070683_1008873702 | 128 |
| 29 | 3300006847 | Ga0075431_100256881 | Ga0075431_1002568811 | 128 |
| 30 | 3300013296 | Ga0157374_10904066 | Ga0157374_109040661 | 128 |
| 31 | 3300014325 | Ga0163163_11956071 | Ga0163163_119560712 | 128 |
| 32 | 3300044706 | Ga0466964_0883489 | Ga0466964_0883489_50_487 | 128 |
| 33 | 3300045976 | Ga0466967_0251765 | Ga0466967_0251765_544_960 | 128 |
| 34 | 3300053078 | Ga0495612_0401677 | Ga0495612_0401677_185_580 | 128 |
| 35 | 3300005327 | Ga0070658_10000146 | Ga0070658_1000014651 | 129 |
| 36 | 3300005327 | Ga0070658_10092250 | Ga0070658_100922505 | 129 |
| 37 | 3300005327 | Ga0070658_10239130 | Ga0070658_102391302 | 129 |
| 38 | 3300005327 | Ga0070658_10918148 | Ga0070658_109181482 | 129 |
| 39 | 3300005329 | Ga0070683_100204756 | Ga0070683_1002047563 | 129 |
| 40 | 3300005336 | Ga0070680_100001370 | Ga0070680_1000013701 | 129 |
| 41 | 3300005336 | Ga0070680_100082091 | Ga0070680_1000820912 | 129 |
| 42 | 3300005338 | Ga0068868_100736509 | Ga0068868_1007365092 | 129 |
| 43 | 3300005339 | Ga0070660_100037627 | Ga0070660_1000376272 | 129 |
| 44 | 3300005339 | Ga0070660_100140161 | Ga0070660_1001401613 | 129 |
| 45 | 3300005345 | Ga0070692_10018973 | Ga0070692_100189733 | 129 |
| 46 | 3300005347 | Ga0070668_100473845 | Ga0070668_1004738452 | 129 |
| 47 | 3300005366 | Ga0070659_100000453 | Ga0070659_10000045325 | 129 |
| 48 | 3300005366 | Ga0070659_100031227 | Ga0070659_1000312273 | 129 |
| 49 | 3300005458 | Ga0070681_10000993 | Ga0070681_100009936 | 129 |
| 50 | 3300005458 | Ga0070681_10347354 | Ga0070681_103473542 | 129 |
| 51 | 3300005458 | Ga0070681_10568222 | Ga0070681_105682222 | 129 |
| 52 | 3300005530 | Ga0070679_100014840 | Ga0070679_1000148406 | 129 |
| 53 | 3300005530 | Ga0070679_100034915 | Ga0070679_1000349157 | 129 |
| 54 | 3300005530 | Ga0070679_100382514 | Ga0070679_1003825142 | 129 |
| 55 | 3300005530 | Ga0070679_100893484 | Ga0070679_1008934842 | 129 |
| 56 | 3300005530 | Ga0070679_101587276 | Ga0070679_1015872761 | 129 |
| 57 | 3300005543 | Ga0070672_101599784 | Ga0070672_1015997841 | 129 |
| 58 | 3300005548 | Ga0070665_100393071 | Ga0070665_1003930712 | 129 |
| 59 | 3300005618 | Ga0068864_100013245 | Ga0068864_1000132453 | 129 |
| 60 | 3300005718 | Ga0068866_10549079 | Ga0068866_105490791 | 129 |
| 61 | 3300009147 | Ga0114129_10231201 | Ga0114129_102312014 | 129 |
| 62 | 3300009545 | Ga0105237_10056763 | Ga0105237_100567632 | 129 |
| 63 | 3300013100 | Ga0157373_10146270 | Ga0157373_101462702 | 129 |
| 64 | 3300013102 | Ga0157371_10026125 | Ga0157371_100261253 | 129 |
| 65 | 3300013104 | Ga0157370_10101681 | Ga0157370_101016813 | 129 |
| 66 | 3300013105 | Ga0157369_10043080 | Ga0157369_100430803 | 129 |
| 67 | 3300013307 | Ga0157372_11088657 | Ga0157372_110886572 | 129 |
| 68 | 3300014325 | Ga0163163_10105992 | Ga0163163_101059921 | 129 |
| 69 | 3300014325 | Ga0163163_10221615 | Ga0163163_102216151 | 129 |
| 70 | 3300020069 | Ga0197907_10031296 | Ga0197907_100312961 | 129 |
| 71 | 3300020082 | Ga0206353_11840558 | Ga0206353_118405582 | 129 |
| 72 | 3300022467 | Ga0224712_10331351 | Ga0224712_103313512 | 129 |
| 73 | 3300025909 | Ga0207705_10000242 | Ga0207705_1000024219 | 129 |
| 74 | 3300025909 | Ga0207705_10133623 | Ga0207705_101336232 | 129 |
| 75 | 3300025912 | Ga0207707_10001237 | Ga0207707_1000123717 | 129 |
| 76 | 3300025912 | Ga0207707_10128571 | Ga0207707_101285713 | 129 |
| 77 | 3300025912 | Ga0207707_10329162 | Ga0207707_103291622 | 129 |
| 78 | 3300025914 | Ga0207671_10071520 | Ga0207671_100715203 | 129 |
| 79 | 3300025917 | Ga0207660_10001330 | Ga0207660_100013308 | 129 |
| 80 | 3300025917 | Ga0207660_10334961 | Ga0207660_103349612 | 129 |
| 81 | 3300025919 | Ga0207657_10046393 | Ga0207657_100463932 | 129 |
| 82 | 3300025919 | Ga0207657_10067356 | Ga0207657_100673562 | 129 |
| 83 | 3300025919 | Ga0207657_10169647 | Ga0207657_101696474 | 129 |
| 84 | 3300025921 | Ga0207652_10001227 | Ga0207652_1000122717 | 129 |
| 85 | 3300025921 | Ga0207652_10036055 | Ga0207652_100360556 | 129 |
| 86 | 3300025921 | Ga0207652_10376227 | Ga0207652_103762272 | 129 |
| 87 | 3300025921 | Ga0207652_10581721 | Ga0207652_105817212 | 129 |
| 88 | 3300025921 | Ga0207652_11176898 | Ga0207652_111768982 | 129 |
| 89 | 3300025932 | Ga0207690_10000113 | Ga0207690_100001133 | 129 |
| 90 | 3300025932 | Ga0207690_10110132 | Ga0207690_101101322 | 129 |
| 91 | 3300025944 | Ga0207661_10219660 | Ga0207661_102196603 | 129 |
| 92 | 3300026089 | Ga0207648_11122574 | Ga0207648_111225741 | 129 |
| 93 | 3300026095 | Ga0207676_10069152 | Ga0207676_100691522 | 129 |
| 94 | 3300026118 | Ga0207675_100291590 | Ga0207675_1002915902 | 129 |
| 95 | 3300028379 | Ga0268266_10081980 | Ga0268266_100819803 | 129 |
| 96 | 3300037418 | Ga0395900_1819058 | Ga0395900_1819058_100_510 | 129 |
| 97 | 3300037466 | Ga0395898_0201392 | Ga0395898_0201392_541_951 | 129 |
| 98 | 3300038443 | Ga0395901_0422336 | Ga0395901_0422336_10_420 | 129 |
| 99 | 3300039437 | Ga0436365_0169348 | Ga0436365_0169348_274_681 | 129 |
| 100 | 3300039450 | Ga0436363_1573716 | Ga0436363_1573716_46_453 | 129 |
| 101 | 3300039453 | Ga0436362_0864311 | Ga0436362_0864311_99_506 | 129 |
| 102 | 3300044656 | Ga0466969_0512776 | Ga0466969_0512776_93_509 | 129 |
| 103 | 3300044693 | Ga0466961_0045664 | Ga0466961_0045664_1102_1524 | 129 |
| 104 | 3300044765 | Ga0466970_0600366 | Ga0466970_0600366_39_452 | 129 |
| 105 | 3300045976 | Ga0466967_1335664 | Ga0466967_1335664_15_419 | 129 |
| 106 | 3300048907 | Ga0496104_0190389 | Ga0496104_0190389_1349_1750 | 129 |
| 107 | 3300048908 | Ga0496105_0313841 | Ga0496105_0313841_702_1103 | 129 |
| 108 | 3300048915 | Ga0496112_0019142 | Ga0496112_0019142_3759_4160 | 129 |
| 109 | 3300048915 | Ga0496112_0037108 | Ga0496112_0037108_3984_4385 | 129 |
| 110 | 3300048916 | Ga0496113_0057262 | Ga0496113_0057262_334_735 | 129 |
| 111 | 3300049659 | Ga0501214_044495 | Ga0501214_044495_136_558 | 129 |
| 112 | 3300005329 | Ga0070683_101074095 | Ga0070683_1010740952 | 130 |
| 113 | 3300005337 | Ga0070682_101953379 | Ga0070682_1019533791 | 130 |
| 114 | 3300005366 | Ga0070659_100879599 | Ga0070659_1008795991 | 130 |
| 115 | 3300005367 | Ga0070667_100000049 | Ga0070667_100000049121 | 130 |
| 116 | 3300005455 | Ga0070663_100000512 | Ga0070663_10000051216 | 130 |
| 117 | 3300005457 | Ga0070662_100510695 | Ga0070662_1005106952 | 130 |
| 118 | 3300005539 | Ga0068853_100000503 | Ga0068853_10000050322 | 130 |
| 119 | 3300005547 | Ga0070693_100658069 | Ga0070693_1006580691 | 130 |
| 120 | 3300005841 | Ga0068863_100288154 | Ga0068863_1002881542 | 130 |
| 121 | 3300005842 | Ga0068858_100442941 | Ga0068858_1004429412 | 130 |
| 122 | 3300009177 | Ga0105248_10000231 | Ga0105248_1000023129 | 130 |
| 123 | 3300009545 | Ga0105237_10018854 | Ga0105237_100188546 | 130 |
| 124 | 3300009553 | Ga0105249_10002941 | Ga0105249_100029419 | 130 |
| 125 | 3300010375 | Ga0105239_10731411 | Ga0105239_107314112 | 130 |
| 126 | 3300013307 | Ga0157372_11073594 | Ga0157372_110735942 | 130 |
| 127 | 3300025914 | Ga0207671_10005017 | Ga0207671_1000501715 | 130 |
| 128 | 3300025932 | Ga0207690_10472551 | Ga0207690_104725511 | 130 |
| 129 | 3300025941 | Ga0207711_10005397 | Ga0207711_1000539712 | 130 |
| 130 | 3300025961 | Ga0207712_10005700 | Ga0207712_100057009 | 130 |
| 131 | 3300025986 | Ga0207658_10000033 | Ga0207658_1000003331 | 130 |
| 132 | 3300026035 | Ga0207703_10407626 | Ga0207703_104076262 | 130 |
| 133 | 3300026041 | Ga0207639_10015997 | Ga0207639_100159973 | 130 |
| 134 | 3300026067 | Ga0207678_10000140 | Ga0207678_1000014021 | 130 |
| 135 | 3300026088 | Ga0207641_10471917 | Ga0207641_104719172 | 130 |
| 136 | 3300026142 | Ga0207698_10205161 | Ga0207698_102051612 | 130 |
| 137 | 3300031548 | Ga0307408_100309782 | Ga0307408_1003097822 | 130 |
| 138 | 3300031995 | Ga0307409_100003416 | Ga0307409_1000034165 | 130 |
| 139 | 3300032002 | Ga0307416_100016353 | Ga0307416_1000163534 | 130 |
| 140 | 3300032004 | Ga0307414_10470048 | Ga0307414_104700482 | 130 |
| 141 | 3300032126 | Ga0307415_100229604 | Ga0307415_1002296042 | 130 |
| 142 | 3300041452 | Ga0451793_1268448 | Ga0451793_1268448_796_1224 | 130 |
| 143 | 3300045976 | Ga0466967_0140372 | Ga0466967_0140372_1392_1814 | 130 |
| 144 | 3300047472 | Ga0495686_0003267 | Ga0495686_0003267_5036_5464 | 130 |
| 145 | 3300048905 | Ga0496102_0069915 | Ga0496102_0069915_2420_2836 | 130 |
| 146 | 3300048921 | Ga0496118_0191634 | Ga0496118_0191634_708_1136 | 130 |
| 147 | 3300048924 | Ga0496121_0125367 | Ga0496121_0125367_37_465 | 130 |
| 148 | 3300048925 | Ga0496122_0000362 | Ga0496122_0000362_21989_22417 | 130 |
| 149 | 3300048926 | Ga0496123_0000317 | Ga0496123_0000317_64657_65085 | 130 |
| 150 | 3300049688 | Ga0501259_007430 | Ga0501259_007430_26_448 | 130 |
| 151 | 3300049759 | Ga0501262_036935 | Ga0501262_036935_27_449 | 130 |
| 152 | 3300049764 | Ga0501267_007168 | Ga0501267_007168_603_1025 | 130 |
| 153 | 3300049774 | Ga0501278_010689 | Ga0501278_010689_140_562 | 130 |
| 154 | 3300053087 | Ga0500643_002065 | Ga0500643_002065_2049_2477 | 130 |
| 155 | 3300053120 | Ga0500597_000058 | Ga0500597_000058_4726_5154 | 130 |
| 156 | 3300060344 | Ga0587071_082908 | Ga0587071_082908_247_663 | 130 |
| 157 | 3300003316 | rootH1_10016949 | rootH1_100169493 | 131 |
| 158 | 3300005530 | Ga0070679_100655593 | Ga0070679_1006555931 | 131 |
| 159 | 3300020082 | Ga0206353_10003954 | Ga0206353_100039541 | 131 |
| 160 | 3300025921 | Ga0207652_10433578 | Ga0207652_104335781 | 131 |
| 161 | 3300048911 | Ga0496108_1564453 | Ga0496108_1564453_55_480 | 131 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nxn-assembly1.cif.gz_A | t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11 | 0.7413 | 44 | 122 |
| 3cjt-assembly4.cif.gz_G | ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 | 0.7399 | 44 | 122 |
| 3i58-assembly1.cif.gz_A | crystal structure of an o-methyltransferase (ncsb1) from neocarzinostatin biosynthesis in complex with s-adenosyl-l-homocysteine (sah) and 2-hydroxy-7-methoxy-5-methyl naphthoic acid (na) | 0.7347 | 40 | 125 |
| 4e2x-assembly1.cif.gz_A | x-ray structure of the y222f mutant of tcab9, a c-3'-methyltransferase, in complex with s-adenosyl-l-homocysteine and dtdp | 0.731 | 42 | 127 |
| 3i5u-assembly1.cif.gz_A | crystal structure of an o-methyltransferase (ncsb1) from neocarzinostatin biosynthesis in complex with s-adenosylmethionine (sam) and 2-hydroxy-5-methyl naphthoic acid (mna) | 0.7298 | 40 | 125 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WLG9_29_152_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.825 | 11 | 125 | 3.40.50.150 |
| af_P9WLG9_29_152_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7643 | 11 | 125 | 3.40.50.150 |
| af_A0A0R0KAP7_457_568_3.30.70.240 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7447 | 75 | 122 | 3.30.70.240 |
| af_P9WK97_418_527_3.30.70.240 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7205 | 77 | 126 | 3.30.70.240 |
| af_Q58170_72_142_3.30.110.40 | Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain | 0.7188 | 48 | 122 | 3.30.110.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2A5DFH1-F1-model_v4 | DUF3052 domain-containing protein | 0.9743 | 50 | 125 |
|
| AF-A0A386Z7P1-F1-model_v4 | DUF3052 domain-containing protein | 0.971 | 1 | 129 |
|
| AF-A0A2N1FAY2-F1-model_v4 | DUF3052 domain-containing protein | 0.9705 | 46 | 129 |
|
| AF-A0A6V8KPI8-F1-model_v4 | DUF3052 domain-containing protein | 0.9625 | 52 | 131 |
|
| AF-A0A538EFP1-F1-model_v4 | DUF3052 domain-containing protein | 0.96 | 64 | 129 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar