F235743

General Info

Members Datasets Scaffolds Average Seq Length
160 113 160 159

Family's Representative Sequence

Representative Sequence 3300053730|Ga0500645_005339|Ga0500645_005339_2747_3289
Length 180
Sequence MGPEIKQAPFFVTLKTSKGETNMAIAVGTKAPDFTLKSKQGDNITDIKLSDNFGKKNTVILFFPLAFTGVCTQEMCDVSQGIGAYSSLNATIYAISVDSPFAQDAWAQKEKITIPLLSDLNKKTAEAYGVLLPDLAGFGAASARAAFVVDKDGIIKYSEQTPTPKDLPNFNALKEALKSL

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
24 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
26 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
35 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
37 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
38 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
39 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
40 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
43 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
44 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
45 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
46 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
47 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
48 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
49 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
50 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
51 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
56 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
57 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
58 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
59 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
67 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
68 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
69 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
70 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
71 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
72 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
73 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
74 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
75 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
76 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
77 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
78 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
79 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
80 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
81 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
82 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
83 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
84 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
85 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
86 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
87 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
88 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
89 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
93 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
110 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
111 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
112 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 1.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 1.88
Rhizosphere 96.25
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10052468 3300003322 Bacteria 4006
2 Ga0070658_10038961 3300005327 Bacteria 3834
3 Ga0070690_101109463 3300005330 Bacteria 628
4 Ga0070689_100001126 3300005340 Bacteria 16837
5 Ga0070689_100029092 3300005340 Bacteria 4179
6 Ga0070689_100031462 3300005340 Bacteria 4032
7 Ga0070669_101358409 3300005353 Unclassified 616
8 Ga0070674_100780608 3300005356 Bacteria 823
9 Ga0070688_100089287 3300005365 Bacteria 2011
10 Ga0070711_100219898 3300005439 Bacteria 1476
11 Ga0068855_100357373 3300005563 Bacteria 1608
12 Ga0068856_100874818 3300005614 Bacteria 918
13 Ga0068859_101804024 3300005617 Unclassified 676
14 Ga0068863_100066368 3300005841 Bacteria 3413
15 Ga0068863_100486019 3300005841 Bacteria 1215
16 Ga0081539_10042989 3300005985 Bacteria 2625
17 Ga0070716_100047463 3300006173 Bacteria 2423
18 Ga0075428_100044214 3300006844 Bacteria 4894
19 Ga0075431_100483423 3300006847 Bacteria 1231
20 Ga0075431_101740416 3300006847 Unclassified 580
21 Ga0097620_101804182 3300006931 Unclassified 676
22 Ga0105240_10553690 3300009093 Bacteria 1272
23 Ga0111539_10075551 3300009094 Bacteria 3969
24 Ga0157370_10874767 3300013104 Bacteria 816
25 Ga0157372_10452962 3300013307 Bacteria 1495
26 Ga0163163_10110961 3300014325 Unclassified 2771
27 Ga0157380_12866190 3300014326 Bacteria 549
28 Ga0197907_10095415 3300020069 Bacteria 1493
29 Ga0206355_1142146 3300020076 Bacteria 1078
30 Ga0207699_10237510 3300025906 Bacteria 1251
31 Ga0207663_10012982 3300025916 Bacteria 4518
32 Ga0207663_11082458 3300025916 Bacteria 644
33 Ga0207670_10021886 3300025936 Bacteria 3951
34 Ga0207670_10073543 3300025936 Bacteria 2370
35 Ga0207665_10261185 3300025939 Bacteria 1283
36 Ga0207667_10300523 3300025949 Bacteria 1640
37 Ga0207651_11128328 3300025960 Bacteria 703
38 Ga0207703_10313231 3300026035 Bacteria 1435
39 Ga0207641_10027908 3300026088 Bacteria 4663
40 Ga0207641_10195118 3300026088 Bacteria 1863
41 Ga0207428_10114784 3300027907 Bacteria 2069
42 Ga0268265_10709392 3300028380 Bacteria 973
43 Ga0265319_1006896 3300028563 Bacteria 5185
44 Ga0265319_1016027 3300028563 Bacteria 2881
45 Ga0265334_10050261 3300028573 Bacteria 1602
46 Ga0265334_10066954 3300028573 Bacteria 1343
47 Ga0265318_10035866 3300028577 Bacteria 1905
48 Ga0265323_10071746 3300028653 Bacteria 1183
49 Ga0265322_10087485 3300028654 Unclassified 885
50 Ga0265338_10000158 3300028800 Bacteria 123828
51 Ga0265338_10003126 3300028800 Bacteria 23657
52 Ga0265338_10004295 3300028800 Bacteria 19345
53 Ga0265338_10015916 3300028800 Bacteria 8228
54 Ga0265338_10040392 3300028800 Bacteria 4383
55 Ga0265338_10119604 3300028800 Bacteria 2102
56 Ga0265338_10167998 3300028800 Bacteria 1686
57 Ga0265330_10084934 3300031235 Bacteria 1362
58 Ga0265320_10001009 3300031240 Bacteria 20933
59 Ga0265320_10035546 3300031240 Bacteria 2525
60 Ga0265320_10089455 3300031240 Bacteria 1427
61 Ga0265320_10185068 3300031240 Bacteria 933
62 Ga0265325_10275583 3300031241 Bacteria 755
63 Ga0265339_10282262 3300031249 Bacteria 796
64 Ga0265327_10020002 3300031251 Bacteria 4096
65 Ga0265316_10224644 3300031344 Bacteria 1384
66 Ga0265316_10455035 3300031344 Unclassified 918
67 Ga0265314_10168147 3300031711 Bacteria 1326
68 Ga0265314_10291199 3300031711 Bacteria 919
69 Ga0265342_10100516 3300031712 Unclassified 1648
70 Ga0265342_10184890 3300031712 Bacteria 1140
71 Ga0265342_10368800 3300031712 Bacteria 745
72 Ga0307516_10792349 3300031730 Unclassified 609
73 Ga0307413_11161795 3300031824 Unclassified 670
74 Ga0307412_10186472 3300031911 Bacteria 1565
75 Ga0307416_103011577 3300032002 Unclassified 564
76 Ga0307411_10363312 3300032005 Bacteria 1185
77 Ga0373954_0009305 3300035118 Bacteria 4323
78 Ga0373956_0057539 3300035119 Bacteria 1757
79 Ga0373924_0126025 3300035410 Bacteria 1113
80 Ga0373931_0191561 3300035691 Unclassified 1217
81 Ga0373933_0093110 3300035724 Bacteria 1862
82 Ga0373937_1215506 3300036401 Bacteria 702
83 Ga0395900_0517257 3300037418 Unclassified 1142
84 Ga0395901_0071379 3300038443 Bacteria 3619
85 Ga0451577_0223419 3300042876 Bacteria 1702
86 Ga0451577_0242443 3300042876 Bacteria 1631
87 Ga0453684_0001344 3300044712 Bacteria 72038
88 Ga0453684_0193947 3300044712 Bacteria 2374
89 Ga0451576_1030613 3300045051 Bacteria 862
90 Ga0451576_1117511 3300045051 Unclassified 824
91 Ga0451576_1488511 3300045051 Bacteria 703
92 Ga0495592_0000573 3300046454 Bacteria 26052
93 Ga0495592_0077824 3300046454 Bacteria 2403
94 Ga0495651_0234746 3300046462 Bacteria 1261
95 Ga0495582_0036430 3300046473 Bacteria 2707
96 Ga0495662_0008120 3300046476 Bacteria 5170
97 Ga0495664_0121481 3300046477 Bacteria 1580
98 Ga0495664_0241856 3300046477 Bacteria 1092
99 Ga0495607_0148146 3300046501 Bacteria 1204
100 Ga0495628_0001031 3300046516 Bacteria 25489
101 Ga0495628_0058149 3300046516 Bacteria 3040
102 Ga0495628_0276194 3300046516 Bacteria 1249
103 Ga0495630_0000019 3300046517 Bacteria 182603
104 Ga0495630_0003937 3300046517 Bacteria 10380
105 Ga0495630_0011422 3300046517 Bacteria 6434
106 Ga0495630_0028149 3300046517 Bacteria 4175
107 Ga0495666_0094086 3300046526 Bacteria 1413
108 Ga0495652_0029156 3300046529 Bacteria 4849
109 Ga0495665_0253277 3300046531 Bacteria 906
110 Ga0495586_0000025 3300046535 Bacteria 103401
111 Ga0495586_0029160 3300046535 Bacteria 2954
112 Ga0495586_0465095 3300046535 Unclassified 729
113 Ga0495587_0348347 3300046536 Unclassified 826
114 Ga0495645_0020049 3300046543 Unclassified 4820
115 Ga0495645_0033778 3300046543 Bacteria 3732
116 Ga0495634_0011582 3300046642 Bacteria 6417
117 Ga0495599_0015288 3300046678 Bacteria 4761
118 Ga0495658_0044168 3300046683 Bacteria 2496
119 Ga0495613_0133835 3300046689 Bacteria 1775
120 Ga0495624_0512518 3300046690 Bacteria 717
121 Ga0495674_0000556 3300047319 Bacteria 34661
122 Ga0495674_0003360 3300047319 Bacteria 15534
123 Ga0495674_0005746 3300047319 Bacteria 11893
124 Ga0495674_0431892 3300047319 Bacteria 1060
125 Ga0495676_0003400 3300047321 Bacteria 14391
126 Ga0495680_0550005 3300047322 Unclassified 778
127 Ga0495675_0221082 3300047444 Unclassified 1146
128 Ga0495675_0283823 3300047444 Bacteria 987
129 Ga0495684_0029495 3300047471 Bacteria 4211
130 Ga0495684_0218691 3300047471 Bacteria 1398
131 Ga0496102_1526414 3300048905 Bacteria 586
132 Ga0496107_0039496 3300048910 Bacteria 3386
133 Ga0496115_0005359 3300048918 Bacteria 9333
134 Ga0501031_0082437 3300049568 Bacteria 2096
135 Ga0501032_0002094 3300049569 Bacteria 15732
136 Ga0501033_0066206 3300049570 Bacteria 2656
137 Ga0501034_0708337 3300049571 Unclassified 905
138 Ga0501036_0107423 3300049572 Bacteria 2359
139 Ga0501037_0151269 3300049573 Bacteria 1658
140 Ga0501038_0030421 3300049574 Bacteria 4778
141 Ga0501039_0008166 3300049575 Bacteria 7977
142 Ga0501039_1028765 3300049575 Unclassified 639
143 Ga0501042_0006522 3300049578 Bacteria 7581
144 Ga0501046_0133128 3300049580 Bacteria 1884
145 Ga0501047_0071528 3300049581 Bacteria 3338
146 Ga0501047_0325423 3300049581 Bacteria 1376
147 Ga0501047_1010884 3300049581 Bacteria 645
148 Ga0501048_0092513 3300049582 Bacteria 2132
149 Ga0501070_0123785 3300049586 Bacteria 2137
150 Ga0501080_0059744 3300049742 Bacteria 3548
151 Ga0501080_0063290 3300049742 Bacteria 3443
152 Ga0501035_0008930 3300049822 Bacteria 9325
153 Ga0501044_0185172 3300049823 Bacteria 2047
154 nmdc:mga08y16_1503970_c1 3300050511 Unclassified 634
155 nmdc:mga08y16_751826_c1 3300050511 Bacteria 971
156 nmdc:mga0n895_283667_c1 3300050512 Bacteria 1679
157 Ga0495601_0202061 3300053077 Unclassified 1298
158 Ga0495601_0209722 3300053077 Unclassified 1273
159 Ga0500645_005339 3300053730 Bacteria 4753
160 Ga0501082_0133913 3300060353 Bacteria 2150

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005353 Ga0070669_101358409 Ga0070669_1013584091 150
2 3300005985 Ga0081539_10042989 Ga0081539_100429892 150
3 3300006844 Ga0075428_100044214 Ga0075428_1000442142 150
4 3300006847 Ga0075431_100483423 Ga0075431_1004834233 150
5 3300031824 Ga0307413_11161795 Ga0307413_111617951 150
6 3300037418 Ga0395900_0517257 Ga0395900_0517257_199_738 150
7 3300046501 Ga0495607_0148146 Ga0495607_0148146_690_1151 150
8 3300048905 Ga0496102_1526414 Ga0496102_1526414_57_557 150
9 3300025916 Ga0207663_11082458 Ga0207663_110824581 156
10 3300025906 Ga0207699_10237510 Ga0207699_102375102 157
11 3300049568 Ga0501031_0082437 Ga0501031_0082437_982_1455 157
12 3300049569 Ga0501032_0002094 Ga0501032_0002094_11278_11751 157
13 3300049570 Ga0501033_0066206 Ga0501033_0066206_1232_1705 157
14 3300049572 Ga0501036_0107423 Ga0501036_0107423_875_1348 157
15 3300049573 Ga0501037_0151269 Ga0501037_0151269_413_886 157
16 3300049574 Ga0501038_0030421 Ga0501038_0030421_4038_4511 157
17 3300049575 Ga0501039_0008166 Ga0501039_0008166_3457_3930 157
18 3300049578 Ga0501042_0006522 Ga0501042_0006522_3762_4235 157
19 3300049580 Ga0501046_0133128 Ga0501046_0133128_670_1143 157
20 3300049581 Ga0501047_0071528 Ga0501047_0071528_204_677 157
21 3300049582 Ga0501048_0092513 Ga0501048_0092513_1455_1928 157
22 3300049586 Ga0501070_0123785 Ga0501070_0123785_307_780 157
23 3300049742 Ga0501080_0059744 Ga0501080_0059744_480_953 157
24 3300049822 Ga0501035_0008930 Ga0501035_0008930_6242_6715 157
25 3300049823 Ga0501044_0185172 Ga0501044_0185172_1465_1938 157
26 3300060353 Ga0501082_0133913 Ga0501082_0133913_158_631 157
27 3300028563 Ga0265319_1006896 Ga0265319_10068969 158
28 3300028577 Ga0265318_10035866 Ga0265318_100358662 158
29 3300028800 Ga0265338_10015916 Ga0265338_100159167 158
30 3300028800 Ga0265338_10040392 Ga0265338_100403922 158
31 3300028800 Ga0265338_10119604 Ga0265338_101196042 158
32 3300031240 Ga0265320_10035546 Ga0265320_100355462 158
33 3300031240 Ga0265320_10185068 Ga0265320_101850681 158
34 3300031241 Ga0265325_10275583 Ga0265325_102755831 158
35 3300031711 Ga0265314_10291199 Ga0265314_102911992 158
36 3300031712 Ga0265342_10368800 Ga0265342_103688001 158
37 3300035691 Ga0373931_0191561 Ga0373931_0191561_395_871 158
38 3300048910 Ga0496107_0039496 Ga0496107_0039496_509_985 158
39 3300050512 nmdc:mga0n895_283667_c1 nmdc:mga0n895_283667_c1_961_1437 158
40 3300053730 Ga0500645_005339 Ga0500645_005339_2747_3289 158
41 3300003322 rootL2_10052468 rootL2_100524684 159
42 3300005327 Ga0070658_10038961 Ga0070658_100389613 159
43 3300005330 Ga0070690_101109463 Ga0070690_1011094631 159
44 3300005340 Ga0070689_100001126 Ga0070689_1000011264 159
45 3300005340 Ga0070689_100029092 Ga0070689_1000290923 159
46 3300005340 Ga0070689_100031462 Ga0070689_1000314625 159
47 3300005356 Ga0070674_100780608 Ga0070674_1007806082 159
48 3300005365 Ga0070688_100089287 Ga0070688_1000892874 159
49 3300005439 Ga0070711_100219898 Ga0070711_1002198982 159
50 3300005563 Ga0068855_100357373 Ga0068855_1003573732 159
51 3300005614 Ga0068856_100874818 Ga0068856_1008748182 159
52 3300005617 Ga0068859_101804024 Ga0068859_1018040241 159
53 3300005841 Ga0068863_100066368 Ga0068863_1000663682 159
54 3300005841 Ga0068863_100486019 Ga0068863_1004860192 159
55 3300006173 Ga0070716_100047463 Ga0070716_1000474632 159
56 3300006847 Ga0075431_101740416 Ga0075431_1017404161 159
57 3300006931 Ga0097620_101804182 Ga0097620_1018041821 159
58 3300009093 Ga0105240_10553690 Ga0105240_105536902 159
59 3300009094 Ga0111539_10075551 Ga0111539_100755512 159
60 3300013104 Ga0157370_10874767 Ga0157370_108747671 159
61 3300013307 Ga0157372_10452962 Ga0157372_104529622 159
62 3300014325 Ga0163163_10110961 Ga0163163_101109613 159
63 3300014326 Ga0157380_12866190 Ga0157380_128661901 159
64 3300020069 Ga0197907_10095415 Ga0197907_100954152 159
65 3300020076 Ga0206355_1142146 Ga0206355_11421462 159
66 3300025916 Ga0207663_10012982 Ga0207663_100129821 159
67 3300025936 Ga0207670_10021886 Ga0207670_100218864 159
68 3300025936 Ga0207670_10073543 Ga0207670_100735432 159
69 3300025939 Ga0207665_10261185 Ga0207665_102611852 159
70 3300025949 Ga0207667_10300523 Ga0207667_103005232 159
71 3300025960 Ga0207651_11128328 Ga0207651_111283282 159
72 3300026035 Ga0207703_10313231 Ga0207703_103132312 159
73 3300026088 Ga0207641_10027908 Ga0207641_100279084 159
74 3300026088 Ga0207641_10195118 Ga0207641_101951181 159
75 3300027907 Ga0207428_10114784 Ga0207428_101147842 159
76 3300028380 Ga0268265_10709392 Ga0268265_107093922 159
77 3300028563 Ga0265319_1016027 Ga0265319_10160273 159
78 3300028573 Ga0265334_10050261 Ga0265334_100502612 159
79 3300028573 Ga0265334_10066954 Ga0265334_100669543 159
80 3300028653 Ga0265323_10071746 Ga0265323_100717462 159
81 3300028654 Ga0265322_10087485 Ga0265322_100874852 159
82 3300028800 Ga0265338_10000158 Ga0265338_10000158103 159
83 3300028800 Ga0265338_10003126 Ga0265338_1000312612 159
84 3300028800 Ga0265338_10004295 Ga0265338_1000429515 159
85 3300028800 Ga0265338_10167998 Ga0265338_101679982 159
86 3300031235 Ga0265330_10084934 Ga0265330_100849343 159
87 3300031240 Ga0265320_10001009 Ga0265320_100010094 159
88 3300031240 Ga0265320_10089455 Ga0265320_100894551 159
89 3300031249 Ga0265339_10282262 Ga0265339_102822621 159
90 3300031251 Ga0265327_10020002 Ga0265327_100200024 159
91 3300031344 Ga0265316_10224644 Ga0265316_102246442 159
92 3300031344 Ga0265316_10455035 Ga0265316_104550351 159
93 3300031711 Ga0265314_10168147 Ga0265314_101681472 159
94 3300031712 Ga0265342_10100516 Ga0265342_101005161 159
95 3300031712 Ga0265342_10184890 Ga0265342_101848901 159
96 3300031730 Ga0307516_10792349 Ga0307516_107923491 159
97 3300031911 Ga0307412_10186472 Ga0307412_101864722 159
98 3300032002 Ga0307416_103011577 Ga0307416_1030115771 159
99 3300032005 Ga0307411_10363312 Ga0307411_103633122 159
100 3300035118 Ga0373954_0009305 Ga0373954_0009305_2727_3206 159
101 3300035119 Ga0373956_0057539 Ga0373956_0057539_616_1095 159
102 3300035410 Ga0373924_0126025 Ga0373924_0126025_176_655 159
103 3300035724 Ga0373933_0093110 Ga0373933_0093110_1344_1823 159
104 3300036401 Ga0373937_1215506 Ga0373937_1215506_30_509 159
105 3300038443 Ga0395901_0071379 Ga0395901_0071379_1584_2063 159
106 3300042876 Ga0451577_0223419 Ga0451577_0223419_594_1073 159
107 3300042876 Ga0451577_0242443 Ga0451577_0242443_1094_1573 159
108 3300044712 Ga0453684_0001344 Ga0453684_0001344_48701_49180 159
109 3300044712 Ga0453684_0193947 Ga0453684_0193947_1428_1907 159
110 3300045051 Ga0451576_1030613 Ga0451576_1030613_170_649 159
111 3300045051 Ga0451576_1117511 Ga0451576_1117511_235_714 159
112 3300045051 Ga0451576_1488511 Ga0451576_1488511_153_632 159
113 3300046454 Ga0495592_0000573 Ga0495592_0000573_4252_4731 159
114 3300046454 Ga0495592_0077824 Ga0495592_0077824_607_1086 159
115 3300046462 Ga0495651_0234746 Ga0495651_0234746_209_688 159
116 3300046473 Ga0495582_0036430 Ga0495582_0036430_2114_2593 159
117 3300046476 Ga0495662_0008120 Ga0495662_0008120_3917_4396 159
118 3300046477 Ga0495664_0121481 Ga0495664_0121481_636_1115 159
119 3300046477 Ga0495664_0241856 Ga0495664_0241856_444_923 159
120 3300046516 Ga0495628_0001031 Ga0495628_0001031_21064_21543 159
121 3300046516 Ga0495628_0058149 Ga0495628_0058149_2029_2508 159
122 3300046516 Ga0495628_0276194 Ga0495628_0276194_312_791 159
123 3300046517 Ga0495630_0000019 Ga0495630_0000019_56190_56669 159
124 3300046517 Ga0495630_0003937 Ga0495630_0003937_5181_5660 159
125 3300046517 Ga0495630_0011422 Ga0495630_0011422_4538_5017 159
126 3300046517 Ga0495630_0028149 Ga0495630_0028149_3459_3938 159
127 3300046526 Ga0495666_0094086 Ga0495666_0094086_55_534 159
128 3300046529 Ga0495652_0029156 Ga0495652_0029156_2837_3316 159
129 3300046531 Ga0495665_0253277 Ga0495665_0253277_137_616 159
130 3300046535 Ga0495586_0000025 Ga0495586_0000025_46764_47243 159
131 3300046535 Ga0495586_0029160 Ga0495586_0029160_2449_2928 159
132 3300046535 Ga0495586_0465095 Ga0495586_0465095_156_635 159
133 3300046536 Ga0495587_0348347 Ga0495587_0348347_261_740 159
134 3300046543 Ga0495645_0020049 Ga0495645_0020049_332_811 159
135 3300046543 Ga0495645_0033778 Ga0495645_0033778_3055_3534 159
136 3300046642 Ga0495634_0011582 Ga0495634_0011582_209_688 159
137 3300046678 Ga0495599_0015288 Ga0495599_0015288_4010_4489 159
138 3300046683 Ga0495658_0044168 Ga0495658_0044168_49_528 159
139 3300046689 Ga0495613_0133835 Ga0495613_0133835_592_1071 159
140 3300046690 Ga0495624_0512518 Ga0495624_0512518_193_672 159
141 3300047319 Ga0495674_0000556 Ga0495674_0000556_23277_23756 159
142 3300047319 Ga0495674_0003360 Ga0495674_0003360_12352_12831 159
143 3300047319 Ga0495674_0005746 Ga0495674_0005746_7685_8164 159
144 3300047319 Ga0495674_0431892 Ga0495674_0431892_251_730 159
145 3300047321 Ga0495676_0003400 Ga0495676_0003400_7456_7935 159
146 3300047322 Ga0495680_0550005 Ga0495680_0550005_63_542 159
147 3300047444 Ga0495675_0221082 Ga0495675_0221082_383_862 159
148 3300047444 Ga0495675_0283823 Ga0495675_0283823_176_655 159
149 3300047471 Ga0495684_0029495 Ga0495684_0029495_2978_3457 159
150 3300047471 Ga0495684_0218691 Ga0495684_0218691_736_1215 159
151 3300048918 Ga0496115_0005359 Ga0496115_0005359_6117_6596 159
152 3300049571 Ga0501034_0708337 Ga0501034_0708337_289_768 159
153 3300049575 Ga0501039_1028765 Ga0501039_1028765_141_620 159
154 3300049581 Ga0501047_0325423 Ga0501047_0325423_96_575 159
155 3300049581 Ga0501047_1010884 Ga0501047_1010884_142_621 159
156 3300049742 Ga0501080_0063290 Ga0501080_0063290_1426_1905 159
157 3300050511 nmdc:mga08y16_1503970_c1 nmdc:mga08y16_1503970_c1_55_534 159
158 3300050511 nmdc:mga08y16_751826_c1 nmdc:mga08y16_751826_c1_314_793 159
159 3300053077 Ga0495601_0202061 Ga0495601_0202061_49_528 159
160 3300053077 Ga0495601_0209722 Ga0495601_0209722_442_921 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

27

158

0.94

PF08534

Redoxin

Redoxin

26

177

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cx4-assembly4.cif.gz_H crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal) 0.9221 4 158
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9219 1 159
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9161 1 159
4xih-assembly1.cif.gz_B-2 crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis 0.9141 1 159
4xih-assembly1.cif.gz_B-2 crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis 0.9084 1 159
ID Description Score Start End Superfamily
2cx4E00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9263 4 158 3.40.30.10
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.91 2 159 3.40.30.10
af_A0A0R4J2P7_61_260_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8864 5 156 3.40.30.10
4g2eA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8845 3 159 3.40.30.10
2yzhD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8836 1 159 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A353DWR0-F1-model_v4 Peroxiredoxin 0.989 65 159 GO:0016209
GO:0016491
AF-A0A382PCD9-F1-model_v4 Thioredoxin domain-containing protein 0.9764 1 159 GO:0016209
GO:0016491
AF-A0A382PCD9-F1-model_v4 Thioredoxin domain-containing protein 0.9704 1 159 GO:0016209
GO:0016491
AF-A0A353DWR0-F1-model_v4 Peroxiredoxin 0.9688 65 159 GO:0016209
GO:0016491
AF-A0A3S5IXT7-F1-model_v4 Peroxiredoxin 0.9656 1 155 GO:0016209
GO:0016491

Feature Viewer

pLDDT pTM Quality
85.86 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map