F235618

General Info

Members Datasets Scaffolds Average Seq Length
160 112 320 270

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0002782|Ga0501070_0002782_13829_14737
Length 302
Sequence VSAPFAVGVRGSDAGGPPVREDEGMTRYLVVPQWQGSPSSRAMQLIDGAQAIAGDLPRSATTVLDVPMEAGESLGSGIHRLSALQRVHGLVAEALDAHHAAAPDEAVLTIGGDCGIALAPIAHAARRSPGLAVVWIDAHPDLNAPDSSPSGAFAGMVLRAVLGDGAPDLSLPAGTVAPERVVVGGARSFDDPELDVVAARGIATLTVEALRDAEALADAVVATGADAVYIHVDIDALDPAEIAGNAHPEPFGVTVAELTAAVSALRSRVPLVGASLAGYSPASPSAANDDLGAILRVIGSLA

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
5 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
6 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
7 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
8 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
9 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
10 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
11 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
12 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
13 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
14 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
15 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
16 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
17 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
18 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
19 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
20 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
21 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
22 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
23 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
24 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
25 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
26 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
27 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
28 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
29 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
30 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
31 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
32 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
33 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
34 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
35 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
36 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
37 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
38 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
39 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
40 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
41 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
42 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
43 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
44 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
45 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
46 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
47 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
48 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
49 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
50 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
51 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
52 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
53 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
58 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
65 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
66 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
67 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
68 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
69 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
72 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
73 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
74 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
75 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
76 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
77 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
78 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
79 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
80 2643221546 Microbacterium sp. Root53 Isolate Unclassified
81 2643221566 Microbacterium sp. Root166 Isolate Unclassified
82 2643221597 Microbacterium sp. Root180 Isolate Unclassified
83 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
84 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
85 2773857759 Microbacterium sp. 1294 Isolate Unclassified
86 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
87 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
88 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
89 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
90 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
91 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
92 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
93 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
94 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
95 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
96 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
97 2919069694 Microbacterium sp. 1154 Isolate Unclassified
98 2919395869 Microbacterium resistens 2980 Isolate Unclassified
99 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
100 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
101 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
102 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
103 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
104 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
105 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
106 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
107 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
108 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
109 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
110 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
111 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
112 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.75
Metatranscriptomes 0
Isolates 21.25

Biome Distribution

Category Percentage (%)
Aerial Root 0.62
Bulb 0
Endosphere 8.75
Nodule 0
Rhizoplane 12.5
Rhizosphere 50.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0002782 3300049586 Bacteria 15266
2 JGI24740J21852_10017451 3300001979 Bacteria 2567
3 Ga0070658_10033605 3300005327 Bacteria 4127
4 Ga0075365_10002202 3300006038 Bacteria 9402
5 Ga0075365_10041525 3300006038 Bacteria 3005
6 Ga0075368_10038828 3300006042 Bacteria 1865
7 Ga0075363_100015615 3300006048 Bacteria 3736
8 Ga0075364_10074760 3300006051 Bacteria 2235
9 Ga0075367_10009449 3300006178 Bacteria 5097
10 Ga0105243_10809907 3300009148 Bacteria 924
11 Ga0157370_10158910 3300013104 Bacteria 2103
12 Ga0157369_10015902 3300013105 Bacteria 8472
13 Ga0157369_10214116 3300013105 Bacteria 2019
14 Ga0171462_1001 3300013250 Bacteria 1135406
15 Ga0157380_10570889 3300014326 Bacteria 1113
16 Ga0307405_10497910 3300031731 Bacteria 976
17 Ga0307413_10114516 3300031824 Bacteria 1813
18 Ga0307406_10000025 3300031901 Bacteria 92128
19 Ga0307406_10028886 3300031901 Bacteria 3354
20 Ga0307412_10478976 3300031911 Bacteria 1032
21 Ga0307409_100410689 3300031995 Bacteria 1296
22 Ga0307416_100730379 3300032002 Bacteria 1082
23 Ga0307415_100300955 3300032126 Bacteria 1329
24 Ga0395900_0402479 3300037418 Bacteria 1333
25 Ga0466970_0000835 3300044765 Bacteria 14806
26 Ga0466970_0089349 3300044765 Bacteria 1671
27 Ga0466960_0120544 3300044901 Bacteria 1373
28 Ga0466958_0167045 3300045836 Bacteria 1392
29 Ga0466967_0084466 3300045976 Bacteria 2873
30 Ga0466967_0400618 3300045976 Bacteria 1335
31 Ga0495620_0175423 3300046515 Bacteria 830
32 Ga0495649_0253352 3300046694 Bacteria 904
33 Ga0496100_0004189 3300048903 Bacteria 7606
34 Ga0496101_0012552 3300048904 Bacteria 5655
35 Ga0496102_0032638 3300048905 Bacteria 4678
36 Ga0496103_0011344 3300048906 Bacteria 5278
37 Ga0496104_0241629 3300048907 Bacteria 1718
38 Ga0496105_0065279 3300048908 Bacteria 3004
39 Ga0496105_0123504 3300048908 Bacteria 2134
40 Ga0496107_0004498 3300048910 Bacteria 9457
41 Ga0496108_0094915 3300048911 Bacteria 2539
42 Ga0496109_0022888 3300048912 Bacteria 5538
43 Ga0496109_0314971 3300048912 Bacteria 1476
44 Ga0496110_0113464 3300048913 Bacteria 2437
45 Ga0496110_0612580 3300048913 Bacteria 987
46 Ga0496111_0013028 3300048914 Bacteria 5645
47 Ga0496112_0316458 3300048915 Bacteria 1505
48 Ga0496113_0011890 3300048916 Bacteria 5833
49 Ga0496114_0014564 3300048917 Bacteria 6317
50 Ga0496114_0017556 3300048917 Bacteria 5778
51 Ga0496114_0202533 3300048917 Bacteria 1739
52 Ga0496115_0010422 3300048918 Bacteria 6944
53 Ga0496117_0000028 3300048920 Bacteria 407392
54 Ga0496117_0000214 3300048920 Bacteria 111723
55 Ga0496117_0050803 3300048920 Bacteria 2937
56 Ga0496117_0169635 3300048920 Bacteria 1268
57 Ga0496118_0021820 3300048921 Bacteria 5620
58 Ga0496118_0230019 3300048921 Bacteria 1071
59 Ga0496119_0002724 3300048922 Bacteria 19053
60 Ga0496119_0005584 3300048922 Bacteria 11958
61 Ga0496119_0015395 3300048922 Bacteria 5893
62 Ga0496119_0157263 3300048922 Bacteria 1212
63 Ga0496120_0001254 3300048923 Bacteria 31918
64 Ga0496120_0001547 3300048923 Bacteria 26928
65 Ga0496122_0000055 3300048925 Bacteria 258485
66 Ga0496122_0007136 3300048925 Bacteria 12533
67 Ga0496122_0025632 3300048925 Bacteria 5114
68 Ga0496123_0000003 3300048926 Bacteria 866556
69 Ga0496123_0113016 3300048926 Bacteria 1547
70 Ga0496124_0144268 3300048927 Bacteria 1875
71 Ga0496125_0000120 3300048928 Bacteria 175991
72 Ga0496125_0002489 3300048928 Bacteria 23847
73 Ga0496125_0008113 3300048928 Bacteria 11060
74 Ga0496126_0020054 3300048929 Bacteria 6565
75 Ga0496126_0399571 3300048929 Bacteria 1115
76 Ga0501031_0022595 3300049568 Bacteria 4098
77 Ga0501031_0065490 3300049568 Bacteria 2367
78 Ga0501031_0367675 3300049568 Bacteria 931
79 Ga0501033_0014436 3300049570 Bacteria 5998
80 Ga0501033_0041680 3300049570 Bacteria 3424
81 Ga0501033_0142854 3300049570 Bacteria 1730
82 Ga0501033_0222131 3300049570 Bacteria 1344
83 Ga0501034_0015729 3300049571 Bacteria 7769
84 Ga0501034_0041975 3300049571 Bacteria 4629
85 Ga0501034_0279986 3300049571 Bacteria 1607
86 Ga0501036_0020869 3300049572 Bacteria 5501
87 Ga0501036_0255394 3300049572 Bacteria 1468
88 Ga0501037_0038839 3300049573 Bacteria 3505
89 Ga0501037_0154658 3300049573 Bacteria 1637
90 Ga0501038_0003027 3300049574 Bacteria 15678
91 Ga0501038_0006708 3300049574 Bacteria 10640
92 Ga0501038_0185556 3300049574 Bacteria 1676
93 Ga0501038_0215921 3300049574 Bacteria 1532
94 Ga0501039_0006370 3300049575 Bacteria 8967
95 Ga0501042_0056359 3300049578 Bacteria 2805
96 Ga0501043_0017755 3300049579 Bacteria 5578
97 Ga0501043_0105369 3300049579 Bacteria 2216
98 Ga0501046_0128333 3300049580 Bacteria 1924
99 Ga0501047_0004575 3300049581 Bacteria 13011
100 Ga0501047_0261159 3300049581 Bacteria 1579
101 Ga0501048_0029359 3300049582 Bacteria 3988
102 Ga0501068_0059582 3300049584 Bacteria 2318
103 Ga0501069_0033594 3300049585 Bacteria 2826
104 Ga0501070_0028713 3300049586 Bacteria 4664
105 Ga0501070_0039689 3300049586 Bacteria 3925
106 Ga0501070_0051138 3300049586 Bacteria 3430
107 Ga0501073_0027960 3300049589 Bacteria 4029
108 Ga0501074_0163025 3300049590 Bacteria 1592
109 Ga0501083_0156704 3300049744 Bacteria 1490
110 Ga0501035_0008460 3300049822 Bacteria 9584
111 Ga0501035_0053440 3300049822 Bacteria 3612
112 Ga0501035_0092905 3300049822 Bacteria 2654
113 Ga0501035_0191222 3300049822 Bacteria 1759
114 Ga0501035_0352071 3300049822 Bacteria 1232
115 Ga0501044_0003736 3300049823 Bacteria 17102
116 Ga0501044_0258113 3300049823 Bacteria 1681
117 Ga0501044_0382031 3300049823 Bacteria 1323
118 Ga0501045_0120701 3300049824 Bacteria 1946
119 nmdc:mga03n38_37786_c1 3300050490 Bacteria 2085
120 nmdc:mga00v17_83332_c1 3300050491 Bacteria 2000
121 nmdc:mga0yw44_11754_c1 3300050492 Bacteria 4537
122 nmdc:mga0yw44_237608_c1 3300050492 Bacteria 1210
123 nmdc:mga06z11_47221_c1 3300050494 Bacteria 2186
124 nmdc:mga04h51_145945_c1 3300050495 Bacteria 901
125 nmdc:mga0sz30_53587_c1 3300050516 Bacteria 1714
126 Ga0500616_0000021 3300053153 Bacteria 484527
127 2588106703 2585428157 Bacteria 3018951
128 2643754049 2643221546 Bacteria 2910897
129 2643849417 2643221566 Bacteria 3460379
130 2643996403 2643221597 Bacteria 3347721
131 2758224392 2757320536 Bacteria 3629334
132 2774381343 2773857758 Bacteria 3592392
133 2774383692 2773857759 Bacteria 2963774
134 2774400207 2773857763 Bacteria 4180068
135 2808631703 2808606306 Bacteria 3608896
136 2808885084 2808606368 Bacteria 3174172
137 2812322485 2811994872 Bacteria 4121241
138 2821269405 2821268502 Bacteria 3750023
139 2833710313 2833709550 Bacteria 4008291
140 2852646918 2852646457 Bacteria 3408613
141 2857732299 2857729791 Bacteria 4040535
142 2870629770 2870628048 Bacteria 3696012
143 2904509979 2904509784 Bacteria 3520416
144 2908678810 2908678064 Bacteria 3482747
145 2919071161 2919069694 Bacteria 3622919
146 2919396877 2919395869 Bacteria 3704152
147 2928124809 2928121344 Bacteria 3972376
148 2945971369 2945968032 Bacteria 4111363
149 2946034227 2946033335 Bacteria 3835514
150 2974298007 2974294766 Bacteria 3767688
151 2974325755 2974324384 Bacteria 3750535
152 2977230704 2977228692 Bacteria 3450105
153 2977239505 2977236895 Bacteria 3569373
154 2977251794 2977251589 Bacteria 2952848
155 2977265935 2977264416 Bacteria 3750737
156 2984546226 2984542743 Bacteria 3569378
157 8016254665 8016254467 Bacteria 3797036
158 8045832679 8045830549 Bacteria 4444727
159 8046355838 8046352972 Bacteria 3613806
160 8057348523 8057345674 Bacteria 4160394
161 Ga0501070_0002782
162 JGI24740J21852_10017451
163 Ga0070658_10033605
164 Ga0075365_10002202
165 Ga0075365_10041525
166 Ga0075368_10038828
167 Ga0075363_100015615
168 Ga0075364_10074760
169 Ga0075367_10009449
170 Ga0105243_10809907
171 Ga0157370_10158910
172 Ga0157369_10015902
173 Ga0157369_10214116
174 Ga0171462_1001
175 Ga0157380_10570889
176 Ga0307405_10497910
177 Ga0307413_10114516
178 Ga0307406_10000025
179 Ga0307406_10028886
180 Ga0307412_10478976
181 Ga0307409_100410689
182 Ga0307416_100730379
183 Ga0307415_100300955
184 Ga0395900_0402479
185 Ga0466970_0000835
186 Ga0466970_0089349
187 Ga0466960_0120544
188 Ga0466958_0167045
189 Ga0466967_0084466
190 Ga0466967_0400618
191 Ga0495620_0175423
192 Ga0495649_0253352
193 Ga0496100_0004189
194 Ga0496101_0012552
195 Ga0496102_0032638
196 Ga0496103_0011344
197 Ga0496104_0241629
198 Ga0496105_0065279
199 Ga0496105_0123504
200 Ga0496107_0004498
201 Ga0496108_0094915
202 Ga0496109_0022888
203 Ga0496109_0314971
204 Ga0496110_0113464
205 Ga0496110_0612580
206 Ga0496111_0013028
207 Ga0496112_0316458
208 Ga0496113_0011890
209 Ga0496114_0014564
210 Ga0496114_0017556
211 Ga0496114_0202533
212 Ga0496115_0010422
213 Ga0496117_0000028
214 Ga0496117_0000214
215 Ga0496117_0050803
216 Ga0496117_0169635
217 Ga0496118_0021820
218 Ga0496118_0230019
219 Ga0496119_0002724
220 Ga0496119_0005584
221 Ga0496119_0015395
222 Ga0496119_0157263
223 Ga0496120_0001254
224 Ga0496120_0001547
225 Ga0496122_0000055
226 Ga0496122_0007136
227 Ga0496122_0025632
228 Ga0496123_0000003
229 Ga0496123_0113016
230 Ga0496124_0144268
231 Ga0496125_0000120
232 Ga0496125_0002489
233 Ga0496125_0008113
234 Ga0496126_0020054
235 Ga0496126_0399571
236 Ga0501031_0022595
237 Ga0501031_0065490
238 Ga0501031_0367675
239 Ga0501033_0014436
240 Ga0501033_0041680
241 Ga0501033_0142854
242 Ga0501033_0222131
243 Ga0501034_0015729
244 Ga0501034_0041975
245 Ga0501034_0279986
246 Ga0501036_0020869
247 Ga0501036_0255394
248 Ga0501037_0038839
249 Ga0501037_0154658
250 Ga0501038_0003027
251 Ga0501038_0006708
252 Ga0501038_0185556
253 Ga0501038_0215921
254 Ga0501039_0006370
255 Ga0501042_0056359
256 Ga0501043_0017755
257 Ga0501043_0105369
258 Ga0501046_0128333
259 Ga0501047_0004575
260 Ga0501047_0261159
261 Ga0501048_0029359
262 Ga0501068_0059582
263 Ga0501069_0033594
264 Ga0501070_0028713
265 Ga0501070_0039689
266 Ga0501070_0051138
267 Ga0501073_0027960
268 Ga0501074_0163025
269 Ga0501083_0156704
270 Ga0501035_0008460
271 Ga0501035_0053440
272 Ga0501035_0092905
273 Ga0501035_0191222
274 Ga0501035_0352071
275 Ga0501044_0003736
276 Ga0501044_0258113
277 Ga0501044_0382031
278 Ga0501045_0120701
279 nmdc:mga03n38_37786_c1
280 nmdc:mga00v17_83332_c1
281 nmdc:mga0yw44_11754_c1
282 nmdc:mga0yw44_237608_c1
283 nmdc:mga06z11_47221_c1
284 nmdc:mga04h51_145945_c1
285 nmdc:mga0sz30_53587_c1
286 Ga0500616_0000021
287 2588106703
288 2643754049
289 2643849417
290 2643996403
291 2758224392
292 2774381343
293 2774383692
294 2774400207
295 2808631703
296 2808885084
297 2812322485
298 2821269405
299 2833710313
300 2852646918
301 2857732299
302 2870629770
303 2904509979
304 2908678810
305 2919071161
306 2919396877
307 2928124809
308 2945971369
309 2946034227
310 2974298007
311 2974325755
312 2977230704
313 2977239505
314 2977251794
315 2977265935
316 2984546226
317 8016254665
318 8045832679
319 8046355838
320 8057348523

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00491

Arginase

Arginase family

8

301

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lf2-assembly1.cif.gz_C trimeric human arginase 1 in complex with mab4 0.8467 1 269
3e9b-assembly1.cif.gz_C x-ray structure of rat arginase i-t135a mutant: the complex with bec 0.8428 2 269
1tbl-assembly1.cif.gz_A h141n mutant of rat liver arginase i 0.8414 1 270
7lf2-assembly1.cif.gz_C trimeric human arginase 1 in complex with mab4 0.8409 1 269
5zeh-assembly1.cif.gz_B crystal structure of entamoeba histolytica arginase in complex with l- ornithine at 2.35 a 0.8398 2 269
ID Description Score Start End Superfamily
4iu1A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8042 1 266 3.40.800.10
af_Q10066_16_323_3.40.800.10 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.7962 4 268 3.40.800.10
4iu1A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.7909 1 266 3.40.800.10
af_Q10066_16_323_3.40.800.10 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.7805 4 268 3.40.800.10
3rlaC00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.7789 2 270 3.40.800.10
ID Description Score Start End GO Terms
AF-U3P6X8-F1-model_v4 Arginase 0.9562 177 270 GO:0016813
GO:0046872
AF-A0A1G6KFN8-F1-model_v4 Arginase 0.9476 1 270 GO:0004053
GO:0005829
GO:0019547
GO:0030145
AF-U2RP93-F1-model_v4 Arginase domain protein 0.947 155 270 GO:0008783
GO:0033389
GO:0046872
AF-A0A5C1YB32-F1-model_v4 Arginase family protein 0.9468 1 269 GO:0004053
GO:0005829
GO:0019547
GO:0030145
AF-A0A5B8M7Y6-F1-model_v4 Arginase family protein 0.9442 2 269 GO:0004053
GO:0005829
GO:0019547
GO:0030145

Map