F235618
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 160 | 112 | 320 | 270 |
Family's Representative Sequence
| Representative Sequence | 3300049586|Ga0501070_0002782|Ga0501070_0002782_13829_14737 |
| Length | 302 |
| Sequence | VSAPFAVGVRGSDAGGPPVREDEGMTRYLVVPQWQGSPSSRAMQLIDGAQAIAGDLPRSATTVLDVPMEAGESLGSGIHRLSALQRVHGLVAEALDAHHAAAPDEAVLTIGGDCGIALAPIAHAARRSPGLAVVWIDAHPDLNAPDSSPSGAFAGMVLRAVLGDGAPDLSLPAGTVAPERVVVGGARSFDDPELDVVAARGIATLTVEALRDAEALADAVVATGADAVYIHVDIDALDPAEIAGNAHPEPFGVTVAELTAAVSALRSRVPLVGASLAGYSPASPSAANDDLGAILRVIGSLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 5 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 6 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 7 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 8 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 9 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 10 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 11 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 12 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 13 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 14 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 15 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 16 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 17 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 18 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 19 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 20 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 21 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 22 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 23 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 24 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 25 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 26 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 27 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 28 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 29 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 30 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 31 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 32 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 33 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 34 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 35 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 36 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 37 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 38 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 39 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 40 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 41 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 42 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 43 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 44 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 45 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 46 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 47 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 48 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 49 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 50 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 51 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 52 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 53 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 54 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 55 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 56 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 57 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 58 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 59 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 60 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 61 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 62 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 63 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 64 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 65 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 66 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 67 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 68 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 69 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 70 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 71 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 72 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 73 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 74 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 75 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 76 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 77 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 78 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 79 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 80 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 81 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 82 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 83 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 84 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 85 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 86 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 87 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 88 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 89 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 90 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 91 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 92 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 93 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 94 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 95 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 96 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 97 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 98 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 99 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 100 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 101 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 102 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 103 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 104 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 105 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 106 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 107 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 108 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 109 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 110 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 111 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 112 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.75 |
| Metatranscriptomes | 0 |
| Isolates | 21.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.62 |
| Bulb | 0 |
| Endosphere | 8.75 |
| Nodule | 0 |
| Rhizoplane | 12.5 |
| Rhizosphere | 50.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501070_0002782 | 3300049586 | Bacteria | 15266 |
| 2 | JGI24740J21852_10017451 | 3300001979 | Bacteria | 2567 |
| 3 | Ga0070658_10033605 | 3300005327 | Bacteria | 4127 |
| 4 | Ga0075365_10002202 | 3300006038 | Bacteria | 9402 |
| 5 | Ga0075365_10041525 | 3300006038 | Bacteria | 3005 |
| 6 | Ga0075368_10038828 | 3300006042 | Bacteria | 1865 |
| 7 | Ga0075363_100015615 | 3300006048 | Bacteria | 3736 |
| 8 | Ga0075364_10074760 | 3300006051 | Bacteria | 2235 |
| 9 | Ga0075367_10009449 | 3300006178 | Bacteria | 5097 |
| 10 | Ga0105243_10809907 | 3300009148 | Bacteria | 924 |
| 11 | Ga0157370_10158910 | 3300013104 | Bacteria | 2103 |
| 12 | Ga0157369_10015902 | 3300013105 | Bacteria | 8472 |
| 13 | Ga0157369_10214116 | 3300013105 | Bacteria | 2019 |
| 14 | Ga0171462_1001 | 3300013250 | Bacteria | 1135406 |
| 15 | Ga0157380_10570889 | 3300014326 | Bacteria | 1113 |
| 16 | Ga0307405_10497910 | 3300031731 | Bacteria | 976 |
| 17 | Ga0307413_10114516 | 3300031824 | Bacteria | 1813 |
| 18 | Ga0307406_10000025 | 3300031901 | Bacteria | 92128 |
| 19 | Ga0307406_10028886 | 3300031901 | Bacteria | 3354 |
| 20 | Ga0307412_10478976 | 3300031911 | Bacteria | 1032 |
| 21 | Ga0307409_100410689 | 3300031995 | Bacteria | 1296 |
| 22 | Ga0307416_100730379 | 3300032002 | Bacteria | 1082 |
| 23 | Ga0307415_100300955 | 3300032126 | Bacteria | 1329 |
| 24 | Ga0395900_0402479 | 3300037418 | Bacteria | 1333 |
| 25 | Ga0466970_0000835 | 3300044765 | Bacteria | 14806 |
| 26 | Ga0466970_0089349 | 3300044765 | Bacteria | 1671 |
| 27 | Ga0466960_0120544 | 3300044901 | Bacteria | 1373 |
| 28 | Ga0466958_0167045 | 3300045836 | Bacteria | 1392 |
| 29 | Ga0466967_0084466 | 3300045976 | Bacteria | 2873 |
| 30 | Ga0466967_0400618 | 3300045976 | Bacteria | 1335 |
| 31 | Ga0495620_0175423 | 3300046515 | Bacteria | 830 |
| 32 | Ga0495649_0253352 | 3300046694 | Bacteria | 904 |
| 33 | Ga0496100_0004189 | 3300048903 | Bacteria | 7606 |
| 34 | Ga0496101_0012552 | 3300048904 | Bacteria | 5655 |
| 35 | Ga0496102_0032638 | 3300048905 | Bacteria | 4678 |
| 36 | Ga0496103_0011344 | 3300048906 | Bacteria | 5278 |
| 37 | Ga0496104_0241629 | 3300048907 | Bacteria | 1718 |
| 38 | Ga0496105_0065279 | 3300048908 | Bacteria | 3004 |
| 39 | Ga0496105_0123504 | 3300048908 | Bacteria | 2134 |
| 40 | Ga0496107_0004498 | 3300048910 | Bacteria | 9457 |
| 41 | Ga0496108_0094915 | 3300048911 | Bacteria | 2539 |
| 42 | Ga0496109_0022888 | 3300048912 | Bacteria | 5538 |
| 43 | Ga0496109_0314971 | 3300048912 | Bacteria | 1476 |
| 44 | Ga0496110_0113464 | 3300048913 | Bacteria | 2437 |
| 45 | Ga0496110_0612580 | 3300048913 | Bacteria | 987 |
| 46 | Ga0496111_0013028 | 3300048914 | Bacteria | 5645 |
| 47 | Ga0496112_0316458 | 3300048915 | Bacteria | 1505 |
| 48 | Ga0496113_0011890 | 3300048916 | Bacteria | 5833 |
| 49 | Ga0496114_0014564 | 3300048917 | Bacteria | 6317 |
| 50 | Ga0496114_0017556 | 3300048917 | Bacteria | 5778 |
| 51 | Ga0496114_0202533 | 3300048917 | Bacteria | 1739 |
| 52 | Ga0496115_0010422 | 3300048918 | Bacteria | 6944 |
| 53 | Ga0496117_0000028 | 3300048920 | Bacteria | 407392 |
| 54 | Ga0496117_0000214 | 3300048920 | Bacteria | 111723 |
| 55 | Ga0496117_0050803 | 3300048920 | Bacteria | 2937 |
| 56 | Ga0496117_0169635 | 3300048920 | Bacteria | 1268 |
| 57 | Ga0496118_0021820 | 3300048921 | Bacteria | 5620 |
| 58 | Ga0496118_0230019 | 3300048921 | Bacteria | 1071 |
| 59 | Ga0496119_0002724 | 3300048922 | Bacteria | 19053 |
| 60 | Ga0496119_0005584 | 3300048922 | Bacteria | 11958 |
| 61 | Ga0496119_0015395 | 3300048922 | Bacteria | 5893 |
| 62 | Ga0496119_0157263 | 3300048922 | Bacteria | 1212 |
| 63 | Ga0496120_0001254 | 3300048923 | Bacteria | 31918 |
| 64 | Ga0496120_0001547 | 3300048923 | Bacteria | 26928 |
| 65 | Ga0496122_0000055 | 3300048925 | Bacteria | 258485 |
| 66 | Ga0496122_0007136 | 3300048925 | Bacteria | 12533 |
| 67 | Ga0496122_0025632 | 3300048925 | Bacteria | 5114 |
| 68 | Ga0496123_0000003 | 3300048926 | Bacteria | 866556 |
| 69 | Ga0496123_0113016 | 3300048926 | Bacteria | 1547 |
| 70 | Ga0496124_0144268 | 3300048927 | Bacteria | 1875 |
| 71 | Ga0496125_0000120 | 3300048928 | Bacteria | 175991 |
| 72 | Ga0496125_0002489 | 3300048928 | Bacteria | 23847 |
| 73 | Ga0496125_0008113 | 3300048928 | Bacteria | 11060 |
| 74 | Ga0496126_0020054 | 3300048929 | Bacteria | 6565 |
| 75 | Ga0496126_0399571 | 3300048929 | Bacteria | 1115 |
| 76 | Ga0501031_0022595 | 3300049568 | Bacteria | 4098 |
| 77 | Ga0501031_0065490 | 3300049568 | Bacteria | 2367 |
| 78 | Ga0501031_0367675 | 3300049568 | Bacteria | 931 |
| 79 | Ga0501033_0014436 | 3300049570 | Bacteria | 5998 |
| 80 | Ga0501033_0041680 | 3300049570 | Bacteria | 3424 |
| 81 | Ga0501033_0142854 | 3300049570 | Bacteria | 1730 |
| 82 | Ga0501033_0222131 | 3300049570 | Bacteria | 1344 |
| 83 | Ga0501034_0015729 | 3300049571 | Bacteria | 7769 |
| 84 | Ga0501034_0041975 | 3300049571 | Bacteria | 4629 |
| 85 | Ga0501034_0279986 | 3300049571 | Bacteria | 1607 |
| 86 | Ga0501036_0020869 | 3300049572 | Bacteria | 5501 |
| 87 | Ga0501036_0255394 | 3300049572 | Bacteria | 1468 |
| 88 | Ga0501037_0038839 | 3300049573 | Bacteria | 3505 |
| 89 | Ga0501037_0154658 | 3300049573 | Bacteria | 1637 |
| 90 | Ga0501038_0003027 | 3300049574 | Bacteria | 15678 |
| 91 | Ga0501038_0006708 | 3300049574 | Bacteria | 10640 |
| 92 | Ga0501038_0185556 | 3300049574 | Bacteria | 1676 |
| 93 | Ga0501038_0215921 | 3300049574 | Bacteria | 1532 |
| 94 | Ga0501039_0006370 | 3300049575 | Bacteria | 8967 |
| 95 | Ga0501042_0056359 | 3300049578 | Bacteria | 2805 |
| 96 | Ga0501043_0017755 | 3300049579 | Bacteria | 5578 |
| 97 | Ga0501043_0105369 | 3300049579 | Bacteria | 2216 |
| 98 | Ga0501046_0128333 | 3300049580 | Bacteria | 1924 |
| 99 | Ga0501047_0004575 | 3300049581 | Bacteria | 13011 |
| 100 | Ga0501047_0261159 | 3300049581 | Bacteria | 1579 |
| 101 | Ga0501048_0029359 | 3300049582 | Bacteria | 3988 |
| 102 | Ga0501068_0059582 | 3300049584 | Bacteria | 2318 |
| 103 | Ga0501069_0033594 | 3300049585 | Bacteria | 2826 |
| 104 | Ga0501070_0028713 | 3300049586 | Bacteria | 4664 |
| 105 | Ga0501070_0039689 | 3300049586 | Bacteria | 3925 |
| 106 | Ga0501070_0051138 | 3300049586 | Bacteria | 3430 |
| 107 | Ga0501073_0027960 | 3300049589 | Bacteria | 4029 |
| 108 | Ga0501074_0163025 | 3300049590 | Bacteria | 1592 |
| 109 | Ga0501083_0156704 | 3300049744 | Bacteria | 1490 |
| 110 | Ga0501035_0008460 | 3300049822 | Bacteria | 9584 |
| 111 | Ga0501035_0053440 | 3300049822 | Bacteria | 3612 |
| 112 | Ga0501035_0092905 | 3300049822 | Bacteria | 2654 |
| 113 | Ga0501035_0191222 | 3300049822 | Bacteria | 1759 |
| 114 | Ga0501035_0352071 | 3300049822 | Bacteria | 1232 |
| 115 | Ga0501044_0003736 | 3300049823 | Bacteria | 17102 |
| 116 | Ga0501044_0258113 | 3300049823 | Bacteria | 1681 |
| 117 | Ga0501044_0382031 | 3300049823 | Bacteria | 1323 |
| 118 | Ga0501045_0120701 | 3300049824 | Bacteria | 1946 |
| 119 | nmdc:mga03n38_37786_c1 | 3300050490 | Bacteria | 2085 |
| 120 | nmdc:mga00v17_83332_c1 | 3300050491 | Bacteria | 2000 |
| 121 | nmdc:mga0yw44_11754_c1 | 3300050492 | Bacteria | 4537 |
| 122 | nmdc:mga0yw44_237608_c1 | 3300050492 | Bacteria | 1210 |
| 123 | nmdc:mga06z11_47221_c1 | 3300050494 | Bacteria | 2186 |
| 124 | nmdc:mga04h51_145945_c1 | 3300050495 | Bacteria | 901 |
| 125 | nmdc:mga0sz30_53587_c1 | 3300050516 | Bacteria | 1714 |
| 126 | Ga0500616_0000021 | 3300053153 | Bacteria | 484527 |
| 127 | 2588106703 | 2585428157 | Bacteria | 3018951 |
| 128 | 2643754049 | 2643221546 | Bacteria | 2910897 |
| 129 | 2643849417 | 2643221566 | Bacteria | 3460379 |
| 130 | 2643996403 | 2643221597 | Bacteria | 3347721 |
| 131 | 2758224392 | 2757320536 | Bacteria | 3629334 |
| 132 | 2774381343 | 2773857758 | Bacteria | 3592392 |
| 133 | 2774383692 | 2773857759 | Bacteria | 2963774 |
| 134 | 2774400207 | 2773857763 | Bacteria | 4180068 |
| 135 | 2808631703 | 2808606306 | Bacteria | 3608896 |
| 136 | 2808885084 | 2808606368 | Bacteria | 3174172 |
| 137 | 2812322485 | 2811994872 | Bacteria | 4121241 |
| 138 | 2821269405 | 2821268502 | Bacteria | 3750023 |
| 139 | 2833710313 | 2833709550 | Bacteria | 4008291 |
| 140 | 2852646918 | 2852646457 | Bacteria | 3408613 |
| 141 | 2857732299 | 2857729791 | Bacteria | 4040535 |
| 142 | 2870629770 | 2870628048 | Bacteria | 3696012 |
| 143 | 2904509979 | 2904509784 | Bacteria | 3520416 |
| 144 | 2908678810 | 2908678064 | Bacteria | 3482747 |
| 145 | 2919071161 | 2919069694 | Bacteria | 3622919 |
| 146 | 2919396877 | 2919395869 | Bacteria | 3704152 |
| 147 | 2928124809 | 2928121344 | Bacteria | 3972376 |
| 148 | 2945971369 | 2945968032 | Bacteria | 4111363 |
| 149 | 2946034227 | 2946033335 | Bacteria | 3835514 |
| 150 | 2974298007 | 2974294766 | Bacteria | 3767688 |
| 151 | 2974325755 | 2974324384 | Bacteria | 3750535 |
| 152 | 2977230704 | 2977228692 | Bacteria | 3450105 |
| 153 | 2977239505 | 2977236895 | Bacteria | 3569373 |
| 154 | 2977251794 | 2977251589 | Bacteria | 2952848 |
| 155 | 2977265935 | 2977264416 | Bacteria | 3750737 |
| 156 | 2984546226 | 2984542743 | Bacteria | 3569378 |
| 157 | 8016254665 | 8016254467 | Bacteria | 3797036 |
| 158 | 8045832679 | 8045830549 | Bacteria | 4444727 |
| 159 | 8046355838 | 8046352972 | Bacteria | 3613806 |
| 160 | 8057348523 | 8057345674 | Bacteria | 4160394 |
| 161 | Ga0501070_0002782 | |||
| 162 | JGI24740J21852_10017451 | |||
| 163 | Ga0070658_10033605 | |||
| 164 | Ga0075365_10002202 | |||
| 165 | Ga0075365_10041525 | |||
| 166 | Ga0075368_10038828 | |||
| 167 | Ga0075363_100015615 | |||
| 168 | Ga0075364_10074760 | |||
| 169 | Ga0075367_10009449 | |||
| 170 | Ga0105243_10809907 | |||
| 171 | Ga0157370_10158910 | |||
| 172 | Ga0157369_10015902 | |||
| 173 | Ga0157369_10214116 | |||
| 174 | Ga0171462_1001 | |||
| 175 | Ga0157380_10570889 | |||
| 176 | Ga0307405_10497910 | |||
| 177 | Ga0307413_10114516 | |||
| 178 | Ga0307406_10000025 | |||
| 179 | Ga0307406_10028886 | |||
| 180 | Ga0307412_10478976 | |||
| 181 | Ga0307409_100410689 | |||
| 182 | Ga0307416_100730379 | |||
| 183 | Ga0307415_100300955 | |||
| 184 | Ga0395900_0402479 | |||
| 185 | Ga0466970_0000835 | |||
| 186 | Ga0466970_0089349 | |||
| 187 | Ga0466960_0120544 | |||
| 188 | Ga0466958_0167045 | |||
| 189 | Ga0466967_0084466 | |||
| 190 | Ga0466967_0400618 | |||
| 191 | Ga0495620_0175423 | |||
| 192 | Ga0495649_0253352 | |||
| 193 | Ga0496100_0004189 | |||
| 194 | Ga0496101_0012552 | |||
| 195 | Ga0496102_0032638 | |||
| 196 | Ga0496103_0011344 | |||
| 197 | Ga0496104_0241629 | |||
| 198 | Ga0496105_0065279 | |||
| 199 | Ga0496105_0123504 | |||
| 200 | Ga0496107_0004498 | |||
| 201 | Ga0496108_0094915 | |||
| 202 | Ga0496109_0022888 | |||
| 203 | Ga0496109_0314971 | |||
| 204 | Ga0496110_0113464 | |||
| 205 | Ga0496110_0612580 | |||
| 206 | Ga0496111_0013028 | |||
| 207 | Ga0496112_0316458 | |||
| 208 | Ga0496113_0011890 | |||
| 209 | Ga0496114_0014564 | |||
| 210 | Ga0496114_0017556 | |||
| 211 | Ga0496114_0202533 | |||
| 212 | Ga0496115_0010422 | |||
| 213 | Ga0496117_0000028 | |||
| 214 | Ga0496117_0000214 | |||
| 215 | Ga0496117_0050803 | |||
| 216 | Ga0496117_0169635 | |||
| 217 | Ga0496118_0021820 | |||
| 218 | Ga0496118_0230019 | |||
| 219 | Ga0496119_0002724 | |||
| 220 | Ga0496119_0005584 | |||
| 221 | Ga0496119_0015395 | |||
| 222 | Ga0496119_0157263 | |||
| 223 | Ga0496120_0001254 | |||
| 224 | Ga0496120_0001547 | |||
| 225 | Ga0496122_0000055 | |||
| 226 | Ga0496122_0007136 | |||
| 227 | Ga0496122_0025632 | |||
| 228 | Ga0496123_0000003 | |||
| 229 | Ga0496123_0113016 | |||
| 230 | Ga0496124_0144268 | |||
| 231 | Ga0496125_0000120 | |||
| 232 | Ga0496125_0002489 | |||
| 233 | Ga0496125_0008113 | |||
| 234 | Ga0496126_0020054 | |||
| 235 | Ga0496126_0399571 | |||
| 236 | Ga0501031_0022595 | |||
| 237 | Ga0501031_0065490 | |||
| 238 | Ga0501031_0367675 | |||
| 239 | Ga0501033_0014436 | |||
| 240 | Ga0501033_0041680 | |||
| 241 | Ga0501033_0142854 | |||
| 242 | Ga0501033_0222131 | |||
| 243 | Ga0501034_0015729 | |||
| 244 | Ga0501034_0041975 | |||
| 245 | Ga0501034_0279986 | |||
| 246 | Ga0501036_0020869 | |||
| 247 | Ga0501036_0255394 | |||
| 248 | Ga0501037_0038839 | |||
| 249 | Ga0501037_0154658 | |||
| 250 | Ga0501038_0003027 | |||
| 251 | Ga0501038_0006708 | |||
| 252 | Ga0501038_0185556 | |||
| 253 | Ga0501038_0215921 | |||
| 254 | Ga0501039_0006370 | |||
| 255 | Ga0501042_0056359 | |||
| 256 | Ga0501043_0017755 | |||
| 257 | Ga0501043_0105369 | |||
| 258 | Ga0501046_0128333 | |||
| 259 | Ga0501047_0004575 | |||
| 260 | Ga0501047_0261159 | |||
| 261 | Ga0501048_0029359 | |||
| 262 | Ga0501068_0059582 | |||
| 263 | Ga0501069_0033594 | |||
| 264 | Ga0501070_0028713 | |||
| 265 | Ga0501070_0039689 | |||
| 266 | Ga0501070_0051138 | |||
| 267 | Ga0501073_0027960 | |||
| 268 | Ga0501074_0163025 | |||
| 269 | Ga0501083_0156704 | |||
| 270 | Ga0501035_0008460 | |||
| 271 | Ga0501035_0053440 | |||
| 272 | Ga0501035_0092905 | |||
| 273 | Ga0501035_0191222 | |||
| 274 | Ga0501035_0352071 | |||
| 275 | Ga0501044_0003736 | |||
| 276 | Ga0501044_0258113 | |||
| 277 | Ga0501044_0382031 | |||
| 278 | Ga0501045_0120701 | |||
| 279 | nmdc:mga03n38_37786_c1 | |||
| 280 | nmdc:mga00v17_83332_c1 | |||
| 281 | nmdc:mga0yw44_11754_c1 | |||
| 282 | nmdc:mga0yw44_237608_c1 | |||
| 283 | nmdc:mga06z11_47221_c1 | |||
| 284 | nmdc:mga04h51_145945_c1 | |||
| 285 | nmdc:mga0sz30_53587_c1 | |||
| 286 | Ga0500616_0000021 | |||
| 287 | 2588106703 | |||
| 288 | 2643754049 | |||
| 289 | 2643849417 | |||
| 290 | 2643996403 | |||
| 291 | 2758224392 | |||
| 292 | 2774381343 | |||
| 293 | 2774383692 | |||
| 294 | 2774400207 | |||
| 295 | 2808631703 | |||
| 296 | 2808885084 | |||
| 297 | 2812322485 | |||
| 298 | 2821269405 | |||
| 299 | 2833710313 | |||
| 300 | 2852646918 | |||
| 301 | 2857732299 | |||
| 302 | 2870629770 | |||
| 303 | 2904509979 | |||
| 304 | 2908678810 | |||
| 305 | 2919071161 | |||
| 306 | 2919396877 | |||
| 307 | 2928124809 | |||
| 308 | 2945971369 | |||
| 309 | 2946034227 | |||
| 310 | 2974298007 | |||
| 311 | 2974325755 | |||
| 312 | 2977230704 | |||
| 313 | 2977239505 | |||
| 314 | 2977251794 | |||
| 315 | 2977265935 | |||
| 316 | 2984546226 | |||
| 317 | 8016254665 | |||
| 318 | 8045832679 | |||
| 319 | 8046355838 | |||
| 320 | 8057348523 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lf2-assembly1.cif.gz_C | trimeric human arginase 1 in complex with mab4 | 0.8467 | 1 | 269 |
| 3e9b-assembly1.cif.gz_C | x-ray structure of rat arginase i-t135a mutant: the complex with bec | 0.8428 | 2 | 269 |
| 1tbl-assembly1.cif.gz_A | h141n mutant of rat liver arginase i | 0.8414 | 1 | 270 |
| 7lf2-assembly1.cif.gz_C | trimeric human arginase 1 in complex with mab4 | 0.8409 | 1 | 269 |
| 5zeh-assembly1.cif.gz_B | crystal structure of entamoeba histolytica arginase in complex with l- ornithine at 2.35 a | 0.8398 | 2 | 269 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4iu1A00 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain | 0.8042 | 1 | 266 | 3.40.800.10 |
| af_Q10066_16_323_3.40.800.10 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain | 0.7962 | 4 | 268 | 3.40.800.10 |
| 4iu1A00 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain | 0.7909 | 1 | 266 | 3.40.800.10 |
| af_Q10066_16_323_3.40.800.10 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain | 0.7805 | 4 | 268 | 3.40.800.10 |
| 3rlaC00 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain | 0.7789 | 2 | 270 | 3.40.800.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-U3P6X8-F1-model_v4 | Arginase | 0.9562 | 177 | 270 |
GO:0016813
GO:0046872 |
| AF-A0A1G6KFN8-F1-model_v4 | Arginase | 0.9476 | 1 | 270 |
GO:0004053
GO:0005829 GO:0019547 GO:0030145 |
| AF-U2RP93-F1-model_v4 | Arginase domain protein | 0.947 | 155 | 270 |
GO:0008783
GO:0033389 GO:0046872 |
| AF-A0A5C1YB32-F1-model_v4 | Arginase family protein | 0.9468 | 1 | 269 |
GO:0004053
GO:0005829 GO:0019547 GO:0030145 |
| AF-A0A5B8M7Y6-F1-model_v4 | Arginase family protein | 0.9442 | 2 | 269 |
GO:0004053
GO:0005829 GO:0019547 GO:0030145 |