F235409

General Info

Members Datasets Scaffolds Average Seq Length
160 141 320 306

Family's Representative Sequence

Representative Sequence 3300046648|Ga0495611_0072026|Ga0495611_0072026_273_1334
Length 353
Sequence MIDRRTFVGLAAAASLSENARPAFSQGRDDEIEKRDTAVPSEKHLTEPIQPFSIVDAHQHFWDLQRNYLPWLRDEPPIPFRYGNYSALKRNYMPVDYRRDAQGIDVAGSVFVETEWDRSDPVGETRWVHELASSAGLPSVMVCHVILHRPDAPDILAQQATYPLVRGVRHKPATAEQSQKITVGLDGSMTDPAWRRGYSQLERNRLSFDLQVPWWHLKEALALNKDFPNIPMILNHTGLPRTRAADEISNWRKAMEEFATAPNVSAKISGLGEPGLPWTLERNRQIILDTIAIFGEDRCMFGSNFPVDSLVGSMATIFRGFAEATKSRGIAVQQKLFSENAKRIYRLPVGGTK

Samples

Sample ID Description Type Environment
1 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
93 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
94 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
95 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
100 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
101 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
102 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
106 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
107 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
108 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
109 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
110 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
111 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
112 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
121 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
122 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
123 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
126 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
127 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
128 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
129 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
130 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
131 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
132 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
133 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 2643221572 Leifsonia sp. Root60 Isolate Unclassified
136 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
137 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
138 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
139 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
140 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
141 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.62
Metatranscriptomes 0
Isolates 4.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.25
Nodule 0.62
Rhizoplane 0.62
Rhizosphere 82.5
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495611_0072026 3300046648 Bacteria 1581
2 JGI25406J46586_10004133 3300003203 Bacteria 6775
3 Ga0070676_10049297 3300005328 Bacteria 2465
4 Ga0070683_100068896 3300005329 Bacteria 3297
5 Ga0070690_100105574 3300005330 Bacteria 1873
6 Ga0070677_10011450 3300005333 Bacteria 3059
7 Ga0068869_100097408 3300005334 Bacteria 2221
8 Ga0070666_10167751 3300005335 Bacteria 1537
9 Ga0068868_100124581 3300005338 Bacteria 2104
10 Ga0070689_100114509 3300005340 Bacteria 2148
11 Ga0070689_100115232 3300005340 Bacteria 2142
12 Ga0070689_100217768 3300005340 Bacteria 1565
13 Ga0070675_100416621 3300005354 Bacteria 1201
14 Ga0070673_100032953 3300005364 Bacteria 3906
15 Ga0070667_100198539 3300005367 Bacteria 1780
16 Ga0070700_100077645 3300005441 Bacteria 2136
17 Ga0070678_100015776 3300005456 Bacteria 4811
18 Ga0070662_100017363 3300005457 Bacteria 4852
19 Ga0068867_100001222 3300005459 Bacteria 17680
20 Ga0068867_100122723 3300005459 Bacteria 2009
21 Ga0070707_100085518 3300005468 Bacteria 3049
22 Ga0070679_100189339 3300005530 Bacteria 2027
23 Ga0070679_100369796 3300005530 Bacteria 1381
24 Ga0070684_100145100 3300005535 Bacteria 2148
25 Ga0070693_100170356 3300005547 Bacteria 1394
26 Ga0070665_100597089 3300005548 Bacteria 1117
27 Ga0068855_100108537 3300005563 Bacteria 3188
28 Ga0070702_100148168 3300005615 Bacteria 1503
29 Ga0068864_100026987 3300005618 Bacteria 4845
30 Ga0068863_100181039 3300005841 Bacteria 2023
31 Ga0081539_10005746 3300005985 Bacteria 12400
32 Ga0075363_100066084 3300006048 Bacteria 1956
33 Ga0075364_10040648 3300006051 Bacteria 3016
34 Ga0075362_10002293 3300006177 Bacteria 6388
35 Ga0075367_10056120 3300006178 Bacteria 2339
36 Ga0075366_10014678 3300006195 Bacteria 4477
37 Ga0075428_100273081 3300006844 Bacteria 1819
38 Ga0075431_100006600 3300006847 Bacteria 11527
39 Ga0105240_10341043 3300009093 Bacteria 1702
40 Ga0111539_10157478 3300009094 Bacteria 2657
41 Ga0105245_10015332 3300009098 Bacteria 6679
42 Ga0105245_10077071 3300009098 Bacteria 3038
43 Ga0105243_10003846 3300009148 Bacteria 11997
44 Ga0105243_10288784 3300009148 Bacteria 1481
45 Ga0105241_10177653 3300009174 Bacteria 1763
46 Ga0105242_10583904 3300009176 Bacteria 1077
47 Ga0105237_10038827 3300009545 Bacteria 4808
48 Ga0105238_10003461 3300009551 Bacteria 15706
49 Ga0105246_10023035 3300011119 Bacteria 4026
50 Ga0105246_10046037 3300011119 Bacteria 2974
51 Ga0163162_10416112 3300013306 Bacteria 1476
52 Ga0163162_10481892 3300013306 Bacteria 1372
53 Ga0163162_10770995 3300013306 Bacteria 1080
54 Ga0157372_10271888 3300013307 Bacteria 1969
55 Ga0157375_10276649 3300013308 Bacteria 1841
56 Ga0157380_10403545 3300014326 Bacteria 1298
57 Ga0157379_10133261 3300014968 Bacteria 2237
58 Ga0207697_10068091 3300025315 Bacteria 1489
59 Ga0207682_10010794 3300025893 Bacteria 3578
60 Ga0207688_10234732 3300025901 Bacteria 1108
61 Ga0207680_10222110 3300025903 Bacteria 1295
62 Ga0207645_10065254 3300025907 Bacteria 2326
63 Ga0207643_10081257 3300025908 Bacteria 1878
64 Ga0207695_10312745 3300025913 Bacteria 1461
65 Ga0207662_10059523 3300025918 Bacteria 2289
66 Ga0207652_10269454 3300025921 Bacteria 1536
67 Ga0207681_10096168 3300025923 Bacteria 2126
68 Ga0207650_10136995 3300025925 Bacteria 1921
69 Ga0207687_10095718 3300025927 Bacteria 2175
70 Ga0207706_10046207 3300025933 Bacteria 3855
71 Ga0207709_10004300 3300025935 Bacteria 8252
72 Ga0207670_10064361 3300025936 Bacteria 2513
73 Ga0207669_10240643 3300025937 Bacteria 1341
74 Ga0207691_10002411 3300025940 Bacteria 18297
75 Ga0207691_10124720 3300025940 Bacteria 2279
76 Ga0207689_10058584 3300025942 Bacteria 3168
77 Ga0207661_10040858 3300025944 Bacteria 3649
78 Ga0207667_10246763 3300025949 Unclassified 1827
79 Ga0207667_10272739 3300025949 Bacteria 1729
80 Ga0207651_10045813 3300025960 Bacteria 2936
81 Ga0207640_10097480 3300025981 Bacteria 2053
82 Ga0207658_10403201 3300025986 Bacteria 1202
83 Ga0207677_10109502 3300026023 Bacteria 2054
84 Ga0207639_10099733 3300026041 Bacteria 2344
85 Ga0207708_10082447 3300026075 Bacteria 2472
86 Ga0207648_10008411 3300026089 Bacteria 9995
87 Ga0207648_10045404 3300026089 Bacteria 3854
88 Ga0207676_10256147 3300026095 Bacteria 1578
89 Ga0207674_10109156 3300026116 Bacteria 2743
90 Ga0207683_10010176 3300026121 Bacteria 8021
91 Ga0207683_10079489 3300026121 Bacteria 2907
92 Ga0268266_10074883 3300028379 Bacteria 2940
93 Ga0307513_10117435 3300031456 Bacteria 2637
94 Ga0307413_10190519 3300031824 Bacteria 1472
95 Ga0307518_10118116 3300031838 Bacteria 1881
96 Ga0307410_10017424 3300031852 Bacteria 4314
97 Ga0307407_10015339 3300031903 Bacteria 3785
98 Ga0307412_10004927 3300031911 Bacteria 7459
99 Ga0307409_100004037 3300031995 Bacteria 8151
100 Ga0307416_100000219 3300032002 Bacteria 30216
101 Ga0307416_100001985 3300032002 Bacteria 11476
102 Ga0307415_100011019 3300032126 Bacteria 5151
103 Ga0395905_0180871 3300037471 Bacteria 1980
104 Ga0436364_0257159 3300037853 Bacteria 1923
105 Ga0436361_0238585 3300039447 Bacteria 3650
106 Ga0439453_0004070 3300041408 Bacteria 2152
107 Ga0439461_0031536 3300041410 Bacteria 1107
108 Ga0439460_0011532 3300042461 Bacteria 2280
109 Ga0495638_0001933 3300046460 Bacteria 17805
110 Ga0495580_0004786 3300046472 Bacteria 11338
111 Ga0495632_0084090 3300046519 Bacteria 1515
112 Ga0495643_0151489 3300046522 Bacteria 1148
113 Ga0495648_0004701 3300046524 Bacteria 11579
114 Ga0495621_0018409 3300046539 Bacteria 2267
115 Ga0495621_0018657 3300046539 Bacteria 2255
116 Ga0495633_0050879 3300046558 Bacteria 1952
117 Ga0495656_0120772 3300046615 Bacteria 1236
118 Ga0495668_0039376 3300046616 Bacteria 2639
119 Ga0495625_0159882 3300046660 Unclassified 1510
120 Ga0495659_0003866 3300046664 Bacteria 4756
121 Ga0495588_0008640 3300046674 Bacteria 4680
122 Ga0495588_0118915 3300046674 Bacteria 1393
123 Ga0495649_0026173 3300046694 Bacteria 3247
124 Ga0495636_0027139 3300047318 Bacteria 2332
125 Ga0495672_0001421 3300047320 Bacteria 23540
126 Ga0495683_0001967 3300047323 Bacteria 12826
127 Ga0495677_0015866 3300047445 Bacteria 2735
128 Ga0495681_0063888 3300047470 Bacteria 1688
129 Ga0496115_0113493 3300048918 Bacteria 2227
130 Ga0501034_0073326 3300049571 Bacteria 3432
131 Ga0501034_0212897 3300049571 Bacteria 1887
132 Ga0501034_0272118 3300049571 Bacteria 1634
133 Ga0501047_0114363 3300049581 Bacteria 2581
134 Ga0501070_0143361 3300049586 Bacteria 1972
135 Ga0501072_0261000 3300049588 Bacteria 1379
136 Ga0501035_0342525 3300049822 Bacteria 1252
137 Ga0501044_0321668 3300049823 Bacteria 1471
138 nmdc:mga03n38_5382_c1 3300050490 Bacteria 4352
139 nmdc:mga00v17_16367_c1 3300050491 Bacteria 4180
140 nmdc:mga06z11_16492_c1 3300050494 Bacteria 3330
141 nmdc:mga04h51_7154_c1 3300050495 Bacteria 2933
142 nmdc:mga06r32_12156_c1 3300050510 Bacteria 7765
143 Ga0500643_000006 3300053087 Bacteria 479605
144 Ga0500643_002680 3300053087 Bacteria 8960
145 Ga0500646_0008598 3300053090 Bacteria 2614
146 Ga0500641_0078469 3300053096 Bacteria 1399
147 Ga0500658_0002724 3300053134 Bacteria 6793
148 Ga0500568_0011204 3300053139 Bacteria 4176
149 Ga0500573_0000031 3300053140 Bacteria 134098
150 Ga0500604_0047357 3300053151 Bacteria 1317
151 Ga0500616_0056311 3300053153 Bacteria 2053
152 Ga0501084_0280776 3300054114 Bacteria 1406
153 Ga0501082_0076477 3300060353 Bacteria 2886
154 2643876669 2643221572 Bacteria 3614809
155 2644383724 2643221669 Bacteria 3611286
156 2776265141 2775506901 Bacteria 9631051
157 2876810724 2876808645 Bacteria 8824342
158 2879116011 2879110137 Bacteria 8907982
159 2945960779 2945956166 Bacteria 5110334
160 3003669314 3003665799 Bacteria 7279786
161 Ga0495611_0072026
162 JGI25406J46586_10004133
163 Ga0070676_10049297
164 Ga0070683_100068896
165 Ga0070690_100105574
166 Ga0070677_10011450
167 Ga0068869_100097408
168 Ga0070666_10167751
169 Ga0068868_100124581
170 Ga0070689_100114509
171 Ga0070689_100115232
172 Ga0070689_100217768
173 Ga0070675_100416621
174 Ga0070673_100032953
175 Ga0070667_100198539
176 Ga0070700_100077645
177 Ga0070678_100015776
178 Ga0070662_100017363
179 Ga0068867_100001222
180 Ga0068867_100122723
181 Ga0070707_100085518
182 Ga0070679_100189339
183 Ga0070679_100369796
184 Ga0070684_100145100
185 Ga0070693_100170356
186 Ga0070665_100597089
187 Ga0068855_100108537
188 Ga0070702_100148168
189 Ga0068864_100026987
190 Ga0068863_100181039
191 Ga0081539_10005746
192 Ga0075363_100066084
193 Ga0075364_10040648
194 Ga0075362_10002293
195 Ga0075367_10056120
196 Ga0075366_10014678
197 Ga0075428_100273081
198 Ga0075431_100006600
199 Ga0105240_10341043
200 Ga0111539_10157478
201 Ga0105245_10015332
202 Ga0105245_10077071
203 Ga0105243_10003846
204 Ga0105243_10288784
205 Ga0105241_10177653
206 Ga0105242_10583904
207 Ga0105237_10038827
208 Ga0105238_10003461
209 Ga0105246_10023035
210 Ga0105246_10046037
211 Ga0163162_10416112
212 Ga0163162_10481892
213 Ga0163162_10770995
214 Ga0157372_10271888
215 Ga0157375_10276649
216 Ga0157380_10403545
217 Ga0157379_10133261
218 Ga0207697_10068091
219 Ga0207682_10010794
220 Ga0207688_10234732
221 Ga0207680_10222110
222 Ga0207645_10065254
223 Ga0207643_10081257
224 Ga0207695_10312745
225 Ga0207662_10059523
226 Ga0207652_10269454
227 Ga0207681_10096168
228 Ga0207650_10136995
229 Ga0207687_10095718
230 Ga0207706_10046207
231 Ga0207709_10004300
232 Ga0207670_10064361
233 Ga0207669_10240643
234 Ga0207691_10002411
235 Ga0207691_10124720
236 Ga0207689_10058584
237 Ga0207661_10040858
238 Ga0207667_10246763
239 Ga0207667_10272739
240 Ga0207651_10045813
241 Ga0207640_10097480
242 Ga0207658_10403201
243 Ga0207677_10109502
244 Ga0207639_10099733
245 Ga0207708_10082447
246 Ga0207648_10008411
247 Ga0207648_10045404
248 Ga0207676_10256147
249 Ga0207674_10109156
250 Ga0207683_10010176
251 Ga0207683_10079489
252 Ga0268266_10074883
253 Ga0307513_10117435
254 Ga0307413_10190519
255 Ga0307518_10118116
256 Ga0307410_10017424
257 Ga0307407_10015339
258 Ga0307412_10004927
259 Ga0307409_100004037
260 Ga0307416_100000219
261 Ga0307416_100001985
262 Ga0307415_100011019
263 Ga0395905_0180871
264 Ga0436364_0257159
265 Ga0436361_0238585
266 Ga0439453_0004070
267 Ga0439461_0031536
268 Ga0439460_0011532
269 Ga0495638_0001933
270 Ga0495580_0004786
271 Ga0495632_0084090
272 Ga0495643_0151489
273 Ga0495648_0004701
274 Ga0495621_0018409
275 Ga0495621_0018657
276 Ga0495633_0050879
277 Ga0495656_0120772
278 Ga0495668_0039376
279 Ga0495625_0159882
280 Ga0495659_0003866
281 Ga0495588_0008640
282 Ga0495588_0118915
283 Ga0495649_0026173
284 Ga0495636_0027139
285 Ga0495672_0001421
286 Ga0495683_0001967
287 Ga0495677_0015866
288 Ga0495681_0063888
289 Ga0496115_0113493
290 Ga0501034_0073326
291 Ga0501034_0212897
292 Ga0501034_0272118
293 Ga0501047_0114363
294 Ga0501070_0143361
295 Ga0501072_0261000
296 Ga0501035_0342525
297 Ga0501044_0321668
298 nmdc:mga03n38_5382_c1
299 nmdc:mga00v17_16367_c1
300 nmdc:mga06z11_16492_c1
301 nmdc:mga04h51_7154_c1
302 nmdc:mga06r32_12156_c1
303 Ga0500643_000006
304 Ga0500643_002680
305 Ga0500646_0008598
306 Ga0500641_0078469
307 Ga0500658_0002724
308 Ga0500568_0011204
309 Ga0500573_0000031
310 Ga0500604_0047357
311 Ga0500616_0056311
312 Ga0501084_0280776
313 Ga0501082_0076477
314 2643876669
315 2644383724
316 2776265141
317 2876810724
318 2879116011
319 2945960779
320 3003669314

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

55

347

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uvz-assembly5.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8378 11 306
6uvz-assembly4.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8342 11 305
4do7-assembly2.cif.gz_B crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 0.8293 11 306
4dnm-assembly1.cif.gz_A crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 0.8291 11 306
6uvz-assembly5.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8286 11 306
ID Description Score Start End Superfamily
4do7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8293 11 306 3.20.20.140
4do7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8238 11 306 3.20.20.140
af_A0A0R0KUU2_4_202_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8046 85 292 3.20.20.140
af_A0A0R0KUU2_4_202_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7972 85 292 3.20.20.140
4i6kA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7774 11 306 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A2L1S8M2-F1-model_v4 Thioesterase 0.9913 12 305 GO:0016787
AF-A0A0G4JSL0-F1-model_v4 Mll5767 protein 0.9895 215 306 GO:0016787
AF-A0A3S1FUA1-F1-model_v4 Thioesterase 0.9878 214 306 GO:0016787
AF-A0A2E7ZKK7-F1-model_v4 Thioesterase 0.9876 9 305 GO:0016787
AF-A0A658B6N4-F1-model_v4 Amidohydrolase 0.9859 190 306 GO:0016787

Map