F234526

General Info

Members Datasets Scaffolds Average Seq Length
160 86 318 211

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10131347|Ga0105242_101313472
Length 224
Sequence MTNMFAAPGSASLGQKLTRDAAERISANWWRLLLNGAALIVAGVLIFSIDWSVRSLSTFIGALFIFEGLAGALFSGIDRRAGRTNVLAGVLSIAAGIAIIVWPTPGLVAVAVFLGAWLIVVGTLTISGAFAVRRLMPDWWLWLVVGLLEIPLGVLALANPGATLAALITVAGIWAVAIGVMRIILAFQVKDLPETVDAAFAGPVNNAKSTDAEPGSSRPAPAGV

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
11 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
53 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
60 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
61 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
62 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
63 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
64 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
65 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
66 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
67 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
68 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
69 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
70 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
71 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
72 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
73 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
74 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
75 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
76 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
77 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
78 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
79 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
80 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
81 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
82 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
83 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
84 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
85 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
86 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 23.12
Rhizosphere 70.62
Stem 0
Stem Tuber 0
Unclassified 19.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10131347 3300009176 Bacteria 2162
2 JGI25406J46586_10008618 3300003203 Bacteria 4607
3 JGI25406J46586_10099623 3300003203 Bacteria 868
4 Ga0070670_100698685 3300005331 Bacteria 912
5 Ga0070682_100673190 3300005337 Bacteria 826
6 Ga0070668_100222297 3300005347 Unclassified 1558
7 Ga0070674_100006349 3300005356 Bacteria 6893
8 Ga0070700_100142939 3300005441 Bacteria 1628
9 Ga0070700_100258511 3300005441 Bacteria 1253
10 Ga0070662_100492267 3300005457 Bacteria 1022
11 Ga0068867_100024148 3300005459 Bacteria 4357
12 Ga0070686_100338846 3300005544 Unclassified 1126
13 Ga0070696_100090359 3300005546 Bacteria 2179
14 Ga0070704_100406430 3300005549 Bacteria 1163
15 Ga0068856_100352113 3300005614 Unclassified 1491
16 Ga0068856_100465646 3300005614 Bacteria 1285
17 Ga0070702_100598591 3300005615 Unclassified 826
18 Ga0068861_100193213 3300005719 Bacteria 1703
19 Ga0068858_100397855 3300005842 Unclassified 1323
20 Ga0081540_1000467 3300005983 Bacteria 39985
21 Ga0081540_1001398 3300005983 Bacteria 20914
22 Ga0081540_1007696 3300005983 Bacteria 7638
23 Ga0081540_1050342 3300005983 Bacteria 2070
24 Ga0081539_10002574 3300005985 Bacteria 25042
25 Ga0081539_10009910 3300005985 Bacteria 7858
26 Ga0081539_10015820 3300005985 Bacteria 5447
27 Ga0081539_10064485 3300005985 Unclassified 1993
28 Ga0081539_10224089 3300005985 Bacteria 853
29 Ga0070717_10007688 3300006028 Bacteria 8016
30 Ga0070712_100575385 3300006175 Bacteria 951
31 Ga0075430_100084422 3300006846 Bacteria 2659
32 Ga0075431_100190084 3300006847 Bacteria 2104
33 Ga0075433_10227036 3300006852 Unclassified 1658
34 Ga0075434_100005634 3300006871 Bacteria 11419
35 Ga0075435_100031331 3300007076 Bacteria 4188
36 Ga0075435_100616750 3300007076 Bacteria 941
37 Ga0111539_10057683 3300009094 Bacteria 4610
38 Ga0111539_10513542 3300009094 Bacteria 1396
39 Ga0111539_10523290 3300009094 Bacteria 1382
40 Ga0111539_11049401 3300009094 Unclassified 947
41 Ga0105245_10299084 3300009098 Unclassified 1578
42 Ga0114129_10026091 3300009147 Bacteria 8275
43 Ga0114129_10028939 3300009147 Bacteria 7849
44 Ga0114129_10588768 3300009147 Bacteria 1443
45 Ga0114129_11251358 3300009147 Unclassified 922
46 Ga0105243_10015457 3300009148 Bacteria 5769
47 Ga0105243_10360411 3300009148 Bacteria 1338
48 Ga0105243_10565257 3300009148 Unclassified 1089
49 Ga0105249_10188830 3300009553 Bacteria 2010
50 Ga0105249_10352331 3300009553 Bacteria 1492
51 Ga0105249_11282549 3300009553 Bacteria 804
52 Ga0105249_11409687 3300009553 Bacteria 769
53 Ga0105239_10345693 3300010375 Unclassified 1679
54 Ga0105239_11510455 3300010375 Unclassified 776
55 Ga0105246_10058225 3300011119 Bacteria 2676
56 Ga0157378_10580382 3300013297 Bacteria 1130
57 Ga0163162_10415275 3300013306 Bacteria 1478
58 Ga0157372_10773986 3300013307 Bacteria 1116
59 Ga0157372_10785443 3300013307 Unclassified 1107
60 Ga0157380_10124892 3300014326 Bacteria 2185
61 Ga0163161_10197510 3300017792 Unclassified 1549
62 Ga0213874_10005680 3300021377 Bacteria 2917
63 Ga0213874_10015884 3300021377 Bacteria 1993
64 Ga0213876_10082373 3300021384 Bacteria 1702
65 Ga0207687_10400920 3300025927 Unclassified 1128
66 Ga0207664_10494679 3300025929 Unclassified 1095
67 Ga0207709_10263312 3300025935 Bacteria 1265
68 Ga0207709_10368533 3300025935 Unclassified 1089
69 Ga0207669_10094503 3300025937 Bacteria 1956
70 Ga0207669_10691257 3300025937 Bacteria 838
71 Ga0207712_10220049 3300025961 Unclassified 1517
72 Ga0207712_10332384 3300025961 Bacteria 1257
73 Ga0207712_10801595 3300025961 Bacteria 828
74 Ga0207668_10045681 3300025972 Bacteria 2989
75 Ga0207668_10134127 3300025972 Bacteria 1895
76 Ga0207708_10553780 3300026075 Bacteria 970
77 Ga0207648_10405990 3300026089 Bacteria 1235
78 Ga0207676_10046775 3300026095 Bacteria 3350
79 Ga0207675_100067022 3300026118 Bacteria 3355
80 Ga0207675_100340718 3300026118 Bacteria 1468
81 Ga0207675_100490159 3300026118 Unclassified 1222
82 Ga0207428_10046553 3300027907 Bacteria 3488
83 Ga0307409_100783015 3300031995 Unclassified 960
84 Ga0307415_100014189 3300032126 Bacteria 4676
85 Ga0395899_0342156 3300037312 Unclassified 1003
86 Ga0395900_0096045 3300037418 Bacteria 3045
87 Ga0395900_0123541 3300037418 Bacteria 2655
88 Ga0395900_0358648 3300037418 Bacteria 1430
89 Ga0395898_0058604 3300037466 Bacteria 3748
90 Ga0395898_0328304 3300037466 Bacteria 1459
91 Ga0395898_0658002 3300037466 Bacteria 990
92 Ga0395905_0044321 3300037471 Bacteria 4175
93 Ga0395905_0196686 3300037471 Archaea 1891
94 Ga0395905_0491550 3300037471 Bacteria 1127
95 Ga0436364_0511540 3300037853 Bacteria 3474
96 Ga0395901_0005113 3300038443 Bacteria 13247
97 Ga0395901_0062324 3300038443 Bacteria 3881
98 Ga0395901_0086390 3300038443 Bacteria 3280
99 Ga0395901_0190845 3300038443 Bacteria 2149
100 Ga0395901_0479981 3300038443 Unclassified 1268
101 Ga0436365_0618254 3300039437 Bacteria 3822
102 Ga0436365_0651579 3300039437 Bacteria 1032
103 Ga0436363_0034928 3300039450 Bacteria 2152
104 Ga0436363_0580509 3300039450 Bacteria 4323
105 Ga0436363_1019037 3300039450 Unclassified 2164
106 Ga0436363_1142650 3300039450 Bacteria 1370
107 Ga0439459_0054323 3300042438 Unclassified 889
108 Ga0495653_0130292 3300046463 Bacteria 1782
109 Ga0495658_0337711 3300046683 Bacteria 957
110 Ga0496100_0007607 3300048903 Bacteria 5991
111 Ga0496100_0025571 3300048903 Bacteria 3612
112 Ga0496100_0108325 3300048903 Unclassified 1926
113 Ga0496101_0004684 3300048904 Bacteria 8661
114 Ga0496101_0011904 3300048904 Bacteria 5793
115 Ga0496101_0119591 3300048904 Bacteria 1990
116 Ga0496102_0020812 3300048905 Bacteria 5798
117 Ga0496102_0047949 3300048905 Bacteria 3884
118 Ga0496102_0136984 3300048905 Bacteria 2294
119 Ga0496102_0389258 3300048905 Bacteria 1311
120 Ga0496104_0132883 3300048907 Bacteria 2391
121 Ga0496105_0376970 3300048908 Unclassified 1129
122 Ga0496106_0005155 3300048909 Bacteria 9682
123 Ga0496106_0005711 3300048909 Bacteria 9205
124 Ga0496106_0011269 3300048909 Bacteria 6617
125 Ga0496106_0083037 3300048909 Bacteria 2464
126 Ga0496107_0000572 3300048910 Bacteria 20519
127 Ga0496107_0008158 3300048910 Bacteria 7243
128 Ga0496107_0065047 3300048910 Bacteria 2643
129 Ga0496107_0189616 3300048910 Bacteria 1527
130 Ga0496108_0002425 3300048911 Bacteria 14902
131 Ga0496109_0001643 3300048912 Bacteria 18678
132 Ga0496109_0290716 3300048912 Bacteria 1541
133 Ga0496110_0045783 3300048913 Bacteria 3825
134 Ga0496110_0490214 3300048913 Bacteria 1119
135 Ga0496111_0108780 3300048914 Bacteria 2041
136 Ga0496111_0132903 3300048914 Bacteria 1842
137 Ga0496112_0004176 3300048915 Bacteria 12165
138 Ga0496112_0178677 3300048915 Bacteria 2086
139 Ga0496112_0227172 3300048915 Bacteria 1822
140 Ga0496113_0004107 3300048916 Bacteria 8872
141 Ga0496114_0081896 3300048917 Bacteria 2727
142 Ga0496114_0102244 3300048917 Bacteria 2448
143 Ga0496114_0457379 3300048917 Bacteria 1130
144 Ga0496115_0014570 3300048918 Bacteria 5952
145 Ga0496115_0023276 3300048918 Bacteria 4806
146 Ga0496115_0038397 3300048918 Bacteria 3800
147 nmdc:mga05p37_1476_c1 3300050507 Bacteria 27323
148 nmdc:mga05p37_8197_c1 3300050507 Bacteria 12352
149 nmdc:mga09592_1302776_c1 3300050508 Bacteria 597
150 nmdc:mga09592_889088_c1 3300050508 Unclassified 749
151 nmdc:mga0qj67_214662_c1 3300050509 Unclassified 1562
152 nmdc:mga0qj67_46759_c1 3300050509 Bacteria 3417
153 nmdc:mga08y16_431030_c1 3300050511 Unclassified 1346
154 nmdc:mga08y16_71795_c1 3300050511 Bacteria 3607
155 nmdc:mga0n895_16446_c1 3300050512 Bacteria 6789
156 nmdc:mga0rr50_413073_c1 3300050513 Bacteria 1141
157 nmdc:mga0rr50_564084_c1 3300050513 Bacteria 970
158 nmdc:mga08x19_63744_c1 3300050514 Unclassified 2391
159 nmdc:mga0a205_2515_c1 3300050515 Bacteria 16159
160 Ga0105242_10131347
161 JGI25406J46586_10008618
162 JGI25406J46586_10099623
163 Ga0070670_100698685
164 Ga0070682_100673190
165 Ga0070668_100222297
166 Ga0070674_100006349
167 Ga0070700_100142939
168 Ga0070700_100258511
169 Ga0070662_100492267
170 Ga0068867_100024148
171 Ga0070686_100338846
172 Ga0070696_100090359
173 Ga0070704_100406430
174 Ga0068856_100352113
175 Ga0068856_100465646
176 Ga0070702_100598591
177 Ga0068861_100193213
178 Ga0068858_100397855
179 Ga0081540_1000467
180 Ga0081540_1001398
181 Ga0081540_1007696
182 Ga0081540_1050342
183 Ga0081539_10002574
184 Ga0081539_10009910
185 Ga0081539_10015820
186 Ga0081539_10064485
187 Ga0081539_10224089
188 Ga0070717_10007688
189 Ga0070712_100575385
190 Ga0075430_100084422
191 Ga0075431_100190084
192 Ga0075433_10227036
193 Ga0075434_100005634
194 Ga0075435_100031331
195 Ga0075435_100616750
196 Ga0111539_10057683
197 Ga0111539_10513542
198 Ga0111539_10523290
199 Ga0111539_11049401
200 Ga0105245_10299084
201 Ga0114129_10026091
202 Ga0114129_10028939
203 Ga0114129_10588768
204 Ga0114129_11251358
205 Ga0105243_10015457
206 Ga0105243_10360411
207 Ga0105243_10565257
208 Ga0105249_10188830
209 Ga0105249_10352331
210 Ga0105249_11282549
211 Ga0105249_11409687
212 Ga0105239_10345693
213 Ga0105239_11510455
214 Ga0105246_10058225
215 Ga0157378_10580382
216 Ga0163162_10415275
217 Ga0157372_10773986
218 Ga0157372_10785443
219 Ga0157380_10124892
220 Ga0163161_10197510
221 Ga0213874_10005680
222 Ga0213874_10015884
223 Ga0213876_10082373
224 Ga0207687_10400920
225 Ga0207664_10494679
226 Ga0207709_10263312
227 Ga0207709_10368533
228 Ga0207669_10094503
229 Ga0207669_10691257
230 Ga0207712_10220049
231 Ga0207712_10332384
232 Ga0207712_10801595
233 Ga0207668_10045681
234 Ga0207668_10134127
235 Ga0207708_10553780
236 Ga0207648_10405990
237 Ga0207676_10046775
238 Ga0207675_100067022
239 Ga0207675_100340718
240 Ga0207675_100490159
241 Ga0207428_10046553
242 Ga0307409_100783015
243 Ga0307415_100014189
244 Ga0395899_0342156
245 Ga0395900_0096045
246 Ga0395900_0123541
247 Ga0395900_0358648
248 Ga0395898_0058604
249 Ga0395898_0328304
250 Ga0395898_0658002
251 Ga0395905_0044321
252 Ga0395905_0196686
253 Ga0395905_0491550
254 Ga0436364_0511540
255 Ga0395901_0005113
256 Ga0395901_0062324
257 Ga0395901_0086390
258 Ga0395901_0190845
259 Ga0395901_0479981
260 Ga0436365_0618254
261 Ga0436365_0651579
262 Ga0436363_0034928
263 Ga0436363_0580509
264 Ga0436363_1019037
265 Ga0436363_1142650
266 Ga0439459_0054323
267 Ga0495653_0130292
268 Ga0495658_0337711
269 Ga0496100_0007607
270 Ga0496100_0025571
271 Ga0496100_0108325
272 Ga0496101_0004684
273 Ga0496101_0011904
274 Ga0496101_0119591
275 Ga0496102_0020812
276 Ga0496102_0047949
277 Ga0496102_0136984
278 Ga0496102_0389258
279 Ga0496104_0132883
280 Ga0496105_0376970
281 Ga0496106_0005155
282 Ga0496106_0005711
283 Ga0496106_0011269
284 Ga0496106_0083037
285 Ga0496107_0000572
286 Ga0496107_0008158
287 Ga0496107_0065047
288 Ga0496107_0189616
289 Ga0496108_0002425
290 Ga0496109_0001643
291 Ga0496109_0290716
292 Ga0496110_0045783
293 Ga0496110_0490214
294 Ga0496111_0108780
295 Ga0496111_0132903
296 Ga0496112_0004176
297 Ga0496112_0178677
298 Ga0496112_0227172
299 Ga0496113_0004107
300 Ga0496114_0081896
301 Ga0496114_0102244
302 Ga0496114_0457379
303 Ga0496115_0014570
304 Ga0496115_0023276
305 Ga0496115_0038397
306 nmdc:mga05p37_1476_c1
307 nmdc:mga05p37_8197_c1
308 nmdc:mga09592_1302776_c1
309 nmdc:mga09592_889088_c1
310 nmdc:mga0qj67_214662_c1
311 nmdc:mga0qj67_46759_c1
312 nmdc:mga08y16_431030_c1
313 nmdc:mga08y16_71795_c1
314 nmdc:mga0n895_16446_c1
315 nmdc:mga0rr50_413073_c1
316 nmdc:mga0rr50_564084_c1
317 nmdc:mga08x19_63744_c1
318 nmdc:mga0a205_2515_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03729

DUF308

Short repeat of unknown function (DUF308)

144

197

0.94

PF03729

DUF308

Short repeat of unknown function (DUF308)

87

152

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ys3-assembly1.cif.gz_A 1.8 angstrom crystal structure of succinate-acetate permease from citrobacter koseri 0.5201 14 199
5ys3-assembly1.cif.gz_A 1.8 angstrom crystal structure of succinate-acetate permease from citrobacter koseri 0.4878 14 199
5zug-assembly1.cif.gz_F structure of the bacterial acetate channel satp 0.4829 14 199
5zug-assembly1.cif.gz_F structure of the bacterial acetate channel satp 0.4665 14 199
7n7p-assembly1.cif.gz_B cryo-em structure of human tmem120a 0.4103 16 188
ID Description Score Start End Superfamily
af_P53584_2_421_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6262 25 200 1.20.1250.20
af_Q2FWC2_1_116_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.579 52 146 1.20.120.550
af_C7G056_1_101_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5511 52 151 1.10.10.1740
af_P67153_11_209_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.541 16 175 1.20.1070.10
af_C7G056_1_101_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5392 52 151 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A4R1ABY7-F1-model_v4 deleted 0.8029 26 190
AF-A0A662C017-F1-model_v4 HdeD family acid-resistance protein 0.7892 23 184 GO:0005886
AF-A0A077EDJ9-F1-model_v4 DUF308 domain-containing protein 0.7768 27 198 GO:0016020
AF-A0A1H8USU6-F1-model_v4 Uncharacterized membrane protein HdeD, DUF308 family 0.77 3 184 GO:0005886
AF-A0A7D4KEA0-F1-model_v4 deleted 0.7542 1 180

Map