F234512

General Info

Members Datasets Scaffolds Average Seq Length
160 123 320 311

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10000521|Ga0105241_1000052117
Length 351
Sequence MIQIVKQPDRRSPQRSPFLFQEITMTLYKWSQTASADATADSTINWAEGQAPSSVNDSARAMMAATAKYRDDIAGAIVTGGSSTAYTVASYEGFDTLAHLNGQVIAFTPHVTNGATVTLNVDSLGARPLRSAPGAELLAGTIIQGTPYVAVYNNADAAFYLRGFFGNPYNVPLGAGMDYWLPTAPNSSFVFPVGQAISRVTYAALFSQMGTTYGPGDGSTTFNLPDKTGRVSAMKEAVATRLTSGYFGGNSTVMGAVGGSESHTLITGEIPSHIHANTLNDPGHVHGGGQATSQNGAGGTNGSFLAMWFNGPTNTNLAATGVTINNVAAGGGTPHAIVQPTIICNYIIRII

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
51 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
52 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
53 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
54 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
92 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
109 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
112 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
113 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
114 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
117 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
118 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
119 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
120 2922425934
121 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
122 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
123 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.23
Metatranscriptomes 0
Isolates 3.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.38
Nodule 4.38
Rhizoplane 13.75
Rhizosphere 66.88
Stem 0
Stem Tuber 0
Unclassified 4.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10000521 3300009174 Bacteria 28934
2 JGI24744J21845_10006186 3300002077 Bacteria 2484
3 Ga0070690_100060403 3300005330 Bacteria 2439
4 Ga0070689_100046444 3300005340 Bacteria 3347
5 Ga0070671_100007608 3300005355 Bacteria 8664
6 Ga0070674_100151513 3300005356 Bacteria 1750
7 Ga0070688_100004023 3300005365 Bacteria 7629
8 Ga0070713_100059786 3300005436 Bacteria 3184
9 Ga0070701_10060693 3300005438 Bacteria 1992
10 Ga0070694_100168348 3300005444 Bacteria 1612
11 Ga0068867_100028834 3300005459 Bacteria 3996
12 Ga0070679_100006270 3300005530 Bacteria 11072
13 Ga0070684_100121735 3300005535 Bacteria 2347
14 Ga0068853_100083104 3300005539 Bacteria 2805
15 Ga0068853_100167846 3300005539 Unclassified 1984
16 Ga0070672_100044186 3300005543 Bacteria 3439
17 Ga0070665_100009522 3300005548 Bacteria 9825
18 Ga0070664_100047306 3300005564 Bacteria 3633
19 Ga0070664_100204963 3300005564 Bacteria 1761
20 Ga0068854_100015585 3300005578 Bacteria 5039
21 Ga0068854_100028401 3300005578 Bacteria 3866
22 Ga0068856_100000066 3300005614 Bacteria 98376
23 Ga0068856_100000952 3300005614 Bacteria 31012
24 Ga0068856_100019322 3300005614 Bacteria 6614
25 Ga0068852_100143356 3300005616 Bacteria 2213
26 Ga0068852_100159573 3300005616 Bacteria 2104
27 Ga0068852_100210992 3300005616 Bacteria 1842
28 Ga0068859_100044130 3300005617 Bacteria 4481
29 Ga0068859_100051632 3300005617 Bacteria 4133
30 Ga0068864_100060532 3300005618 Bacteria 3278
31 Ga0068861_100024494 3300005719 Bacteria 4365
32 Ga0068851_10072027 3300005834 Bacteria 1789
33 Ga0068870_10010095 3300005840 Bacteria 4320
34 Ga0068858_100011085 3300005842 Bacteria 8524
35 Ga0068858_100326864 3300005842 Bacteria 1466
36 Ga0068860_100033333 3300005843 Bacteria 4943
37 Ga0068860_100226939 3300005843 Bacteria 1814
38 Ga0068862_100182649 3300005844 Bacteria 1883
39 Ga0081455_10017197 3300005937 Bacteria 6942
40 Ga0075365_10009310 3300006038 Bacteria 5636
41 Ga0075365_10042640 3300006038 Viruses 2967
42 Ga0075365_10098852 3300006038 Bacteria 1997
43 Ga0075363_100017105 3300006048 Bacteria 3590
44 Ga0075362_10012924 3300006177 Bacteria 3329
45 Ga0075366_10049168 3300006195 Viruses 2502
46 Ga0068871_100259458 3300006358 Bacteria 1515
47 Ga0075428_100036117 3300006844 Bacteria 5445
48 Ga0075431_100062133 3300006847 Bacteria 3854
49 Ga0068865_100035774 3300006881 Bacteria 3343
50 Ga0097620_100044132 3300006931 Bacteria 4481
51 Ga0097620_100051631 3300006931 Bacteria 4133
52 Ga0105247_10005319 3300009101 Bacteria 8115
53 Ga0114129_10008415 3300009147 Bacteria 14695
54 Ga0105248_10385464 3300009177 Unclassified 1578
55 Ga0105237_10064095 3300009545 Bacteria 3672
56 Ga0105237_10327424 3300009545 Bacteria 1536
57 Ga0105237_10341837 3300009545 Bacteria 1501
58 Ga0105239_10004683 3300010375 Bacteria 16240
59 Ga0105239_10031140 3300010375 Bacteria 5869
60 Ga0105246_10021523 3300011119 Bacteria 4150
61 Ga0157374_10077564 3300013296 Bacteria 3145
62 Ga0157378_10155268 3300013297 Bacteria 2136
63 Ga0157375_10143152 3300013308 Bacteria 2519
64 Ga0163163_10052694 3300014325 Bacteria 4015
65 Ga0157379_10013579 3300014968 Bacteria 7138
66 Ga0157379_10061036 3300014968 Bacteria 3371
67 Ga0214544_1009420 3300021320 Bacteria 15329
68 Ga0214542_1009340 3300021321 Bacteria 15329
69 Ga0214545_1009105 3300021324 Bacteria 15329
70 Ga0214543_1009339 3300021327 Bacteria 15329
71 Ga0209677_101602 3300025253 Bacteria 9553
72 Ga0209758_1003220 3300025297 Bacteria 15206
73 Ga0209758_1004148 3300025297 Bacteria 12349
74 Ga0209257_1025097 3300025304 Bacteria 2045
75 Ga0207656_10027759 3300025321 Bacteria 2318
76 Ga0207688_10002479 3300025901 Bacteria 9929
77 Ga0207647_10024939 3300025904 Bacteria 3937
78 Ga0207643_10064745 3300025908 Bacteria 2092
79 Ga0207654_10000618 3300025911 Bacteria 20077
80 Ga0207695_10001209 3300025913 Bacteria 44290
81 Ga0207671_10010363 3300025914 Bacteria 7699
82 Ga0207671_10017930 3300025914 Bacteria 5446
83 Ga0207663_10058993 3300025916 Bacteria 2425
84 Ga0207663_10354259 3300025916 Bacteria 1112
85 Ga0207660_10047215 3300025917 Viruses 3043
86 Ga0207694_10000206 3300025924 Bacteria 58137
87 Ga0207687_10284229 3300025927 Bacteria 1327
88 Ga0207644_10085332 3300025931 Bacteria 2342
89 Ga0207706_10010749 3300025933 Bacteria 8357
90 Ga0207709_10012173 3300025935 Bacteria 4741
91 Ga0207669_10007590 3300025937 Bacteria 5030
92 Ga0207689_10002163 3300025942 Bacteria 18488
93 Ga0207689_10103464 3300025942 Bacteria 2340
94 Ga0207679_10124671 3300025945 Bacteria 2057
95 Ga0207639_10076111 3300026041 Bacteria 2641
96 Ga0207678_10046241 3300026067 Bacteria 3764
97 Ga0207708_10001223 3300026075 Bacteria 19391
98 Ga0207702_10000026 3300026078 Bacteria 186067
99 Ga0207702_10000044 3300026078 Bacteria 149419
100 Ga0207702_10008521 3300026078 Bacteria 8645
101 Ga0207641_10059811 3300026088 Bacteria 3246
102 Ga0207674_10115382 3300026116 Unclassified 2657
103 Ga0268266_10003426 3300028379 Bacteria 15859
104 Ga0268265_10025107 3300028380 Bacteria 4225
105 Ga0268264_10048803 3300028381 Bacteria 3521
106 Ga0307516_10193555 3300031730 Unclassified 1757
107 Ga0373946_0063892 3300035171 Bacteria 1573
108 Ga0373931_0159427 3300035691 Unclassified 1321
109 Ga0373933_0025946 3300035724 Bacteria 3361
110 Ga0395899_0016174 3300037312 Bacteria 5686
111 Ga0395900_0000708 3300037418 Bacteria 44416
112 Ga0395900_0045742 3300037418 Bacteria 4508
113 Ga0395900_0055527 3300037418 Bacteria 4078
114 Ga0395898_0001021 3300037466 Bacteria 43637
115 Ga0395898_0002167 3300037466 Bacteria 24071
116 Ga0395898_0138582 3300037466 Bacteria 2329
117 Ga0395898_0140138 3300037466 Bacteria 2315
118 Ga0395898_0250427 3300037466 Bacteria 1689
119 Ga0395901_0001389 3300038443 Bacteria 25307
120 Ga0495605_0106828 3300046474 Bacteria 1281
121 Ga0495589_0065798 3300046794 Bacteria 1777
122 Ga0496101_0007448 3300048904 Bacteria 7092
123 Ga0496102_0115850 3300048905 Bacteria 2500
124 Ga0496102_0331671 3300048905 Bacteria 1433
125 Ga0496103_0004015 3300048906 Bacteria 8939
126 Ga0496104_0068478 3300048907 Bacteria 3373
127 Ga0496105_0069438 3300048908 Bacteria 2911
128 Ga0496106_0103351 3300048909 Unclassified 2211
129 Ga0496107_0004209 3300048910 Bacteria 9722
130 Ga0496108_0018451 3300048911 Bacteria 5711
131 Ga0496108_0028421 3300048911 Bacteria 4626
132 Ga0496109_0000339 3300048912 Bacteria 43633
133 Ga0496110_0001429 3300048913 Bacteria 17261
134 Ga0496110_0004115 3300048913 Bacteria 11236
135 Ga0496111_0002398 3300048914 Bacteria 11301
136 Ga0496112_0004415 3300048915 Bacteria 11908
137 Ga0496112_0076635 3300048915 Viruses 3307
138 Ga0496112_0450024 3300048915 Bacteria 1225
139 Ga0496113_0000208 3300048916 Bacteria 27346
140 Ga0496113_0001192 3300048916 Bacteria 14222
141 Ga0496113_0015668 3300048916 Bacteria 5219
142 Ga0496114_0196103 3300048917 Unclassified 1767
143 Ga0496115_0024035 3300048918 Bacteria 4734
144 Ga0496121_0052874 3300048924 Bacteria 3406
145 Ga0496121_0095482 3300048924 Bacteria 2310
146 Ga0496124_0042978 3300048927 Bacteria 3887
147 Ga0496126_0040343 3300048929 Viruses 4328
148 nmdc:mga03n38_9123_c1 3300050490 Bacteria 3591
149 nmdc:mga00v17_32280_c1 3300050491 Bacteria 3094
150 nmdc:mga0yw44_20212_c1 3300050492 Bacteria 3690
151 nmdc:mga0k408_92509_c1 3300050493 Bacteria 1777
152 nmdc:mga05p37_7147_c1 3300050507 Bacteria 13166
153 Ga0500642_0000895 3300053130 Bacteria 8666
154 2513888364 2513237141 Bacteria 8496279
155 2517894038 2517572143 Bacteria 9484767
156 2885372605 2885366525 Bacteria 8326213
157 2922430089
158 3005512127 3005506211 Bacteria 6943378
159 3005713071 3005710791 Bacteria 7622528
160 8056681257 8056673599 Bacteria 7871253
161 Ga0105241_10000521
162 JGI24744J21845_10006186
163 Ga0070690_100060403
164 Ga0070689_100046444
165 Ga0070671_100007608
166 Ga0070674_100151513
167 Ga0070688_100004023
168 Ga0070713_100059786
169 Ga0070701_10060693
170 Ga0070694_100168348
171 Ga0068867_100028834
172 Ga0070679_100006270
173 Ga0070684_100121735
174 Ga0068853_100083104
175 Ga0068853_100167846
176 Ga0070672_100044186
177 Ga0070665_100009522
178 Ga0070664_100047306
179 Ga0070664_100204963
180 Ga0068854_100015585
181 Ga0068854_100028401
182 Ga0068856_100000066
183 Ga0068856_100000952
184 Ga0068856_100019322
185 Ga0068852_100143356
186 Ga0068852_100159573
187 Ga0068852_100210992
188 Ga0068859_100044130
189 Ga0068859_100051632
190 Ga0068864_100060532
191 Ga0068861_100024494
192 Ga0068851_10072027
193 Ga0068870_10010095
194 Ga0068858_100011085
195 Ga0068858_100326864
196 Ga0068860_100033333
197 Ga0068860_100226939
198 Ga0068862_100182649
199 Ga0081455_10017197
200 Ga0075365_10009310
201 Ga0075365_10042640
202 Ga0075365_10098852
203 Ga0075363_100017105
204 Ga0075362_10012924
205 Ga0075366_10049168
206 Ga0068871_100259458
207 Ga0075428_100036117
208 Ga0075431_100062133
209 Ga0068865_100035774
210 Ga0097620_100044132
211 Ga0097620_100051631
212 Ga0105247_10005319
213 Ga0114129_10008415
214 Ga0105248_10385464
215 Ga0105237_10064095
216 Ga0105237_10327424
217 Ga0105237_10341837
218 Ga0105239_10004683
219 Ga0105239_10031140
220 Ga0105246_10021523
221 Ga0157374_10077564
222 Ga0157378_10155268
223 Ga0157375_10143152
224 Ga0163163_10052694
225 Ga0157379_10013579
226 Ga0157379_10061036
227 Ga0214544_1009420
228 Ga0214542_1009340
229 Ga0214545_1009105
230 Ga0214543_1009339
231 Ga0209677_101602
232 Ga0209758_1003220
233 Ga0209758_1004148
234 Ga0209257_1025097
235 Ga0207656_10027759
236 Ga0207688_10002479
237 Ga0207647_10024939
238 Ga0207643_10064745
239 Ga0207654_10000618
240 Ga0207695_10001209
241 Ga0207671_10010363
242 Ga0207671_10017930
243 Ga0207663_10058993
244 Ga0207663_10354259
245 Ga0207660_10047215
246 Ga0207694_10000206
247 Ga0207687_10284229
248 Ga0207644_10085332
249 Ga0207706_10010749
250 Ga0207709_10012173
251 Ga0207669_10007590
252 Ga0207689_10002163
253 Ga0207689_10103464
254 Ga0207679_10124671
255 Ga0207639_10076111
256 Ga0207678_10046241
257 Ga0207708_10001223
258 Ga0207702_10000026
259 Ga0207702_10000044
260 Ga0207702_10008521
261 Ga0207641_10059811
262 Ga0207674_10115382
263 Ga0268266_10003426
264 Ga0268265_10025107
265 Ga0268264_10048803
266 Ga0307516_10193555
267 Ga0373946_0063892
268 Ga0373931_0159427
269 Ga0373933_0025946
270 Ga0395899_0016174
271 Ga0395900_0000708
272 Ga0395900_0045742
273 Ga0395900_0055527
274 Ga0395898_0001021
275 Ga0395898_0002167
276 Ga0395898_0138582
277 Ga0395898_0140138
278 Ga0395898_0250427
279 Ga0395901_0001389
280 Ga0495605_0106828
281 Ga0495589_0065798
282 Ga0496101_0007448
283 Ga0496102_0115850
284 Ga0496102_0331671
285 Ga0496103_0004015
286 Ga0496104_0068478
287 Ga0496105_0069438
288 Ga0496106_0103351
289 Ga0496107_0004209
290 Ga0496108_0018451
291 Ga0496108_0028421
292 Ga0496109_0000339
293 Ga0496110_0001429
294 Ga0496110_0004115
295 Ga0496111_0002398
296 Ga0496112_0004415
297 Ga0496112_0076635
298 Ga0496112_0450024
299 Ga0496113_0000208
300 Ga0496113_0001192
301 Ga0496113_0015668
302 Ga0496114_0196103
303 Ga0496115_0024035
304 Ga0496121_0052874
305 Ga0496121_0095482
306 Ga0496124_0042978
307 Ga0496126_0040343
308 nmdc:mga03n38_9123_c1
309 nmdc:mga00v17_32280_c1
310 nmdc:mga0yw44_20212_c1
311 nmdc:mga0k408_92509_c1
312 nmdc:mga05p37_7147_c1
313 Ga0500642_0000895
314 2513888364
315 2517894038
316 2885372605
317 2922430089
318 3005512127
319 3005713071
320 8056681257

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

174

232

0.87

Map