F234454

General Info

Members Datasets Scaffolds Average Seq Length
160 88 320 167

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10838457|Ga0105240_108384572
Length 202
Sequence MVLTRLQKEAGRLVQEHKADPKPSTFKTERLKIMNTHSSASVRAETPHETETTQITISDALRRRAQSVINDTSIDPQWRNIIRYALEINDPLLPDLVRRADAGEPIIETMEFSATSETNDDDSAEEKIEVLTEIICRADDKAAAALFLLMGTIENSTHPKLLANTAKHLAFTRCAELNLYGMVDAQIPVVESELLAGKTLST

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
80 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
81 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
82 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
83 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
84 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
85 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
86 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
87 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
88 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10838457 3300009093 Unclassified 993
2 SwRhRL2b_contig_1902743 2162886007 Eukaryota 1226
3 CNBas_1001794 3300000531 Bacteria 1154
4 JGI24749J21850_1016811 3300002076 Unclassified 1028
5 Ga0065704_10003402 3300005289 Unclassified 4534
6 Ga0065707_10091494 3300005295 Unclassified 3928
7 Ga0070670_101775376 3300005331 Bacteria 568
8 Ga0068868_101107808 3300005338 Bacteria 729
9 Ga0070687_100406018 3300005343 Bacteria 895
10 Ga0070661_100598616 3300005344 Unclassified 891
11 Ga0070669_100543611 3300005353 Bacteria 968
12 Ga0070705_100041456 3300005440 Bacteria 2625
13 Ga0070700_100000036 3300005441 Bacteria 111099
14 Ga0070700_100002131 3300005441 Bacteria 10038
15 Ga0070700_100196492 3300005441 Bacteria 1414
16 Ga0070694_100070017 3300005444 Bacteria 2414
17 Ga0070694_100148967 3300005444 Bacteria 1707
18 Ga0068867_100301089 3300005459 Bacteria 1322
19 Ga0070699_100286870 3300005518 Unclassified 1475
20 Ga0070696_100385854 3300005546 Unclassified 1093
21 Ga0070693_100176607 3300005547 Bacteria 1372
22 Ga0070693_100352989 3300005547 Bacteria 1007
23 Ga0068855_100385422 3300005563 Bacteria 1538
24 Ga0070664_100680111 3300005564 Unclassified 958
25 Ga0070664_100778859 3300005564 Bacteria 894
26 Ga0068857_100134406 3300005577 Bacteria 2233
27 Ga0068859_100003607 3300005617 Bacteria 15781
28 Ga0068859_100006576 3300005617 Bacteria 11795
29 Ga0068859_100028424 3300005617 Bacteria 5605
30 Ga0068859_100028813 3300005617 Bacteria 5568
31 Ga0068859_100115146 3300005617 Bacteria 2753
32 Ga0068859_100147424 3300005617 Bacteria 2429
33 Ga0068859_100287678 3300005617 Bacteria 1736
34 Ga0068859_100720748 3300005617 Unclassified 1087
35 Ga0068864_101617958 3300005618 Bacteria 652
36 Ga0068870_10008667 3300005840 Bacteria 4586
37 Ga0068870_10009198 3300005840 Bacteria 4481
38 Ga0068870_10017820 3300005840 Bacteria 3417
39 Ga0068870_10073504 3300005840 Bacteria 1870
40 Ga0068858_100049553 3300005842 Bacteria 3889
41 Ga0068858_100079496 3300005842 Bacteria 3047
42 Ga0068860_100017714 3300005843 Bacteria 6938
43 Ga0068860_100048405 3300005843 Bacteria 4051
44 Ga0068860_100359169 3300005843 Unclassified 1435
45 Ga0068860_100834081 3300005843 Bacteria 936
46 Ga0068860_101037195 3300005843 Unclassified 839
47 Ga0068862_100849313 3300005844 Bacteria 895
48 Ga0068862_101513907 3300005844 Unclassified 676
49 Ga0081539_10005218 3300005985 Bacteria 13451
50 Ga0068871_101228111 3300006358 Bacteria 704
51 Ga0075434_100128106 3300006871 Bacteria 2556
52 Ga0097620_100003607 3300006931 Bacteria 15781
53 Ga0097620_100006576 3300006931 Bacteria 11795
54 Ga0097620_100028422 3300006931 Bacteria 5605
55 Ga0097620_100028813 3300006931 Bacteria 5568
56 Ga0097620_100115145 3300006931 Bacteria 2753
57 Ga0097620_100147422 3300006931 Bacteria 2429
58 Ga0097620_100287685 3300006931 Bacteria 1736
59 Ga0097620_100720742 3300006931 Unclassified 1087
60 Ga0105250_10153589 3300009092 Unclassified 958
61 Ga0111539_10002811 3300009094 Bacteria 23133
62 Ga0105247_10061887 3300009101 Unclassified 2321
63 Ga0105247_10238573 3300009101 Unclassified 1238
64 Ga0105247_10284862 3300009101 Unclassified 1141
65 Ga0114129_11957085 3300009147 Unclassified 710
66 Ga0105243_10036158 3300009148 Bacteria 3831
67 Ga0105243_10722830 3300009148 Unclassified 973
68 Ga0105241_10179519 3300009174 Bacteria 1755
69 Ga0105242_10496553 3300009176 Unclassified 1160
70 Ga0105242_11045481 3300009176 Bacteria 827
71 Ga0105248_10001999 3300009177 Bacteria 22692
72 Ga0105248_10002791 3300009177 Bacteria 19407
73 Ga0105248_10044813 3300009177 Bacteria 4961
74 Ga0105248_10057169 3300009177 Bacteria 4378
75 Ga0105248_10071546 3300009177 Bacteria 3896
76 Ga0105248_11061350 3300009177 Unclassified 915
77 Ga0105249_10063075 3300009553 Bacteria 3404
78 Ga0105249_10947695 3300009553 Unclassified 929
79 Ga0105239_10901029 3300010375 Unclassified 1015
80 Ga0157373_10030687 3300013100 Bacteria 3867
81 Ga0163162_10007118 3300013306 Bacteria 10854
82 Ga0163162_10034392 3300013306 Bacteria 5043
83 Ga0163162_10282199 3300013306 Bacteria 1793
84 Ga0163162_12300514 3300013306 Unclassified 619
85 Ga0157375_10005871 3300013308 Bacteria 10691
86 Ga0157375_10965411 3300013308 Unclassified 993
87 Ga0163163_12973544 3300014325 Unclassified 529
88 Ga0157379_10025117 3300014968 Bacteria 5290
89 Ga0157379_10116793 3300014968 Bacteria 2400
90 Ga0163161_10341893 3300017792 Bacteria 1187
91 Ga0163161_11100998 3300017792 Unclassified 683
92 Ga0207710_10057673 3300025900 Unclassified 1754
93 Ga0207647_10088629 3300025904 Unclassified 1848
94 Ga0207643_10008776 3300025908 Bacteria 5422
95 Ga0207643_10009636 3300025908 Bacteria 5186
96 Ga0207643_10038381 3300025908 Bacteria 2690
97 Ga0207643_10059068 3300025908 Unclassified 2187
98 Ga0207643_10139471 3300025908 Bacteria 1447
99 Ga0207671_10526782 3300025914 Bacteria 942
100 Ga0207662_10692517 3300025918 Bacteria 714
101 Ga0207681_10502130 3300025923 Bacteria 993
102 Ga0207681_10518652 3300025923 Bacteria 978
103 Ga0207694_10118191 3300025924 Bacteria 2114
104 Ga0207687_10605112 3300025927 Bacteria 924
105 Ga0207690_10038584 3300025932 Bacteria 3110
106 Ga0207709_10102967 3300025935 Bacteria 1891
107 Ga0207709_10575531 3300025935 Unclassified 889
108 Ga0207670_10000606 3300025936 Bacteria 19379
109 Ga0207670_10757008 3300025936 Unclassified 807
110 Ga0207711_10003543 3300025941 Bacteria 13516
111 Ga0207711_10005575 3300025941 Bacteria 10645
112 Ga0207711_10013876 3300025941 Bacteria 6691
113 Ga0207711_10167685 3300025941 Bacteria 1991
114 Ga0207689_10957899 3300025942 Unclassified 722
115 Ga0207679_10057320 3300025945 Bacteria 2881
116 Ga0207679_11383242 3300025945 Unclassified 646
117 Ga0207667_10467481 3300025949 Unclassified 1281
118 Ga0207651_11539403 3300025960 Bacteria 599
119 Ga0207712_10004416 3300025961 Bacteria 8886
120 Ga0207712_10566066 3300025961 Unclassified 979
121 Ga0207640_10356095 3300025981 Unclassified 1178
122 Ga0207640_10550999 3300025981 Unclassified 969
123 Ga0207640_10830172 3300025981 Unclassified 803
124 Ga0207703_10036423 3300026035 Bacteria 3916
125 Ga0207703_10557219 3300026035 Bacteria 1081
126 Ga0207639_11644850 3300026041 Unclassified 602
127 Ga0207708_10000016 3300026075 Bacteria 193989
128 Ga0207708_10011076 3300026075 Bacteria 6706
129 Ga0207708_10044398 3300026075 Bacteria 3387
130 Ga0207702_10816729 3300026078 Bacteria 922
131 Ga0207641_11227304 3300026088 Unclassified 750
132 Ga0207648_10041340 3300026089 Bacteria 4048
133 Ga0207648_10169195 3300026089 Unclassified 1931
134 Ga0207648_10295133 3300026089 Unclassified 1452
135 Ga0207648_11285548 3300026089 Unclassified 687
136 Ga0207676_11344659 3300026095 Unclassified 710
137 Ga0207674_10168896 3300026116 Bacteria 2141
138 Ga0207683_10080437 3300026121 Bacteria 2891
139 Ga0207428_10010500 3300027907 Bacteria 8266
140 Ga0268265_10147581 3300028380 Bacteria 1979
141 Ga0268265_10560536 3300028380 Bacteria 1086
142 Ga0268265_10618894 3300028380 Unclassified 1037
143 Ga0268264_10038567 3300028381 Bacteria 3943
144 Ga0268264_10046103 3300028381 Bacteria 3621
145 Ga0268264_10134922 3300028381 Bacteria 2193
146 Ga0268264_10240690 3300028381 Unclassified 1676
147 Ga0268264_10263273 3300028381 Bacteria 1607
148 Ga0307416_101183376 3300032002 Unclassified 870
149 Ga0373951_0057167 3300035091 Unclassified 970
150 Ga0242420_028124 3300038996 Unclassified 1034
151 Ga0501299_044847 3300049522 Unclassified 898
152 Ga0501235_009499 3300049669 Bacteria 2126
153 Ga0501234_054219 3300049707 Unclassified 671
154 Ga0501234_079811 3300049707 Unclassified 575
155 nmdc:mga05p37_875092_c1 3300050507 Unclassified 972
156 nmdc:mga0qj67_987362_c1 3300050509 Unclassified 661
157 nmdc:mga08y16_12434_c1 3300050511 Bacteria 8957
158 nmdc:mga0n895_798668_c1 3300050512 Unclassified 934
159 nmdc:mga0a205_140524_c1 3300050515 Bacteria 2315
160 nmdc:mga0a205_37954_c1 3300050515 Bacteria 4633
161 Ga0105240_10838457
162 SwRhRL2b_contig_1902743
163 CNBas_1001794
164 JGI24749J21850_1016811
165 Ga0065704_10003402
166 Ga0065707_10091494
167 Ga0070670_101775376
168 Ga0068868_101107808
169 Ga0070687_100406018
170 Ga0070661_100598616
171 Ga0070669_100543611
172 Ga0070705_100041456
173 Ga0070700_100000036
174 Ga0070700_100002131
175 Ga0070700_100196492
176 Ga0070694_100070017
177 Ga0070694_100148967
178 Ga0068867_100301089
179 Ga0070699_100286870
180 Ga0070696_100385854
181 Ga0070693_100176607
182 Ga0070693_100352989
183 Ga0068855_100385422
184 Ga0070664_100680111
185 Ga0070664_100778859
186 Ga0068857_100134406
187 Ga0068859_100003607
188 Ga0068859_100006576
189 Ga0068859_100028424
190 Ga0068859_100028813
191 Ga0068859_100115146
192 Ga0068859_100147424
193 Ga0068859_100287678
194 Ga0068859_100720748
195 Ga0068864_101617958
196 Ga0068870_10008667
197 Ga0068870_10009198
198 Ga0068870_10017820
199 Ga0068870_10073504
200 Ga0068858_100049553
201 Ga0068858_100079496
202 Ga0068860_100017714
203 Ga0068860_100048405
204 Ga0068860_100359169
205 Ga0068860_100834081
206 Ga0068860_101037195
207 Ga0068862_100849313
208 Ga0068862_101513907
209 Ga0081539_10005218
210 Ga0068871_101228111
211 Ga0075434_100128106
212 Ga0097620_100003607
213 Ga0097620_100006576
214 Ga0097620_100028422
215 Ga0097620_100028813
216 Ga0097620_100115145
217 Ga0097620_100147422
218 Ga0097620_100287685
219 Ga0097620_100720742
220 Ga0105250_10153589
221 Ga0111539_10002811
222 Ga0105247_10061887
223 Ga0105247_10238573
224 Ga0105247_10284862
225 Ga0114129_11957085
226 Ga0105243_10036158
227 Ga0105243_10722830
228 Ga0105241_10179519
229 Ga0105242_10496553
230 Ga0105242_11045481
231 Ga0105248_10001999
232 Ga0105248_10002791
233 Ga0105248_10044813
234 Ga0105248_10057169
235 Ga0105248_10071546
236 Ga0105248_11061350
237 Ga0105249_10063075
238 Ga0105249_10947695
239 Ga0105239_10901029
240 Ga0157373_10030687
241 Ga0163162_10007118
242 Ga0163162_10034392
243 Ga0163162_10282199
244 Ga0163162_12300514
245 Ga0157375_10005871
246 Ga0157375_10965411
247 Ga0163163_12973544
248 Ga0157379_10025117
249 Ga0157379_10116793
250 Ga0163161_10341893
251 Ga0163161_11100998
252 Ga0207710_10057673
253 Ga0207647_10088629
254 Ga0207643_10008776
255 Ga0207643_10009636
256 Ga0207643_10038381
257 Ga0207643_10059068
258 Ga0207643_10139471
259 Ga0207671_10526782
260 Ga0207662_10692517
261 Ga0207681_10502130
262 Ga0207681_10518652
263 Ga0207694_10118191
264 Ga0207687_10605112
265 Ga0207690_10038584
266 Ga0207709_10102967
267 Ga0207709_10575531
268 Ga0207670_10000606
269 Ga0207670_10757008
270 Ga0207711_10003543
271 Ga0207711_10005575
272 Ga0207711_10013876
273 Ga0207711_10167685
274 Ga0207689_10957899
275 Ga0207679_10057320
276 Ga0207679_11383242
277 Ga0207667_10467481
278 Ga0207651_11539403
279 Ga0207712_10004416
280 Ga0207712_10566066
281 Ga0207640_10356095
282 Ga0207640_10550999
283 Ga0207640_10830172
284 Ga0207703_10036423
285 Ga0207703_10557219
286 Ga0207639_11644850
287 Ga0207708_10000016
288 Ga0207708_10011076
289 Ga0207708_10044398
290 Ga0207702_10816729
291 Ga0207641_11227304
292 Ga0207648_10041340
293 Ga0207648_10169195
294 Ga0207648_10295133
295 Ga0207648_11285548
296 Ga0207676_11344659
297 Ga0207674_10168896
298 Ga0207683_10080437
299 Ga0207428_10010500
300 Ga0268265_10147581
301 Ga0268265_10560536
302 Ga0268265_10618894
303 Ga0268264_10038567
304 Ga0268264_10046103
305 Ga0268264_10134922
306 Ga0268264_10240690
307 Ga0268264_10263273
308 Ga0307416_101183376
309 Ga0373951_0057167
310 Ga0242420_028124
311 Ga0501299_044847
312 Ga0501235_009499
313 Ga0501234_054219
314 Ga0501234_079811
315 nmdc:mga05p37_875092_c1
316 nmdc:mga0qj67_987362_c1
317 nmdc:mga08y16_12434_c1
318 nmdc:mga0n895_798668_c1
319 nmdc:mga0a205_140524_c1
320 nmdc:mga0a205_37954_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map