F234086

General Info

Members Datasets Scaffolds Average Seq Length
160 115 320 161

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100592245|Ga0070697_1005922452
Length 165
Sequence LGLVRKINTNELTELTWSSPKGKFKGAGKQVSEALGRKPQSTDLNERHPFDVEILRIAPGQVPYPYHLHSAQWEFYHVISGKGLVRHQEGTTPIGPGDAFLFKPDEPHQLINSNSEAGQDLVVYVVADNPIGESVYYPDSKKWGVRSPERRIFRGEALDYFDGEE

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
65 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
70 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
75 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
76 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
77 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
91 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
94 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
110 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
111 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
112 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
113 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
114 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
115 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.12
Metatranscriptomes 1.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 1.25
Rhizosphere 92.5
Stem 0
Stem Tuber 0
Unclassified 33.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100592245 3300005536 Bacteria 974
2 Ga0065715_10781433 3300005293 Bacteria 617
3 Ga0070690_100214365 3300005330 Bacteria 1346
4 Ga0070690_100245257 3300005330 Unclassified 1265
5 Ga0070690_100301971 3300005330 Bacteria 1148
6 Ga0070689_100022569 3300005340 Unclassified 4700
7 Ga0070689_100033473 3300005340 Unclassified 3916
8 Ga0070689_100139835 3300005340 Bacteria 1947
9 Ga0070689_100152650 3300005340 Bacteria 1863
10 Ga0070687_100948897 3300005343 Bacteria 620
11 Ga0070675_100929072 3300005354 Unclassified 798
12 Ga0070688_100012087 3300005365 Bacteria 4823
13 Ga0070688_100032521 3300005365 Unclassified 3146
14 Ga0070713_100380446 3300005436 Unclassified 1315
15 Ga0070701_10022220 3300005438 Unclassified 3039
16 Ga0070705_100043502 3300005440 Bacteria 2574
17 Ga0070700_100144071 3300005441 Bacteria 1622
18 Ga0070694_100030926 3300005444 Unclassified 3507
19 Ga0070694_101616305 3300005444 Unclassified 550
20 Ga0070708_100515643 3300005445 Bacteria 1128
21 Ga0068867_101388117 3300005459 Unclassified 651
22 Ga0070706_100164720 3300005467 Bacteria 2070
23 Ga0070707_100326608 3300005468 Bacteria 1490
24 Ga0070686_100009820 3300005544 Bacteria 5375
25 Ga0070686_100106835 3300005544 Bacteria 1900
26 Ga0070686_100495146 3300005544 Unclassified 947
27 Ga0070686_100925352 3300005544 Unclassified 711
28 Ga0070695_100214285 3300005545 Unclassified 1384
29 Ga0070696_100842334 3300005546 Unclassified 757
30 Ga0070704_100012442 3300005549 Bacteria 5257
31 Ga0068857_100067997 3300005577 Bacteria 3172
32 Ga0068857_100215045 3300005577 Bacteria 1754
33 Ga0068856_101766458 3300005614 Unclassified 630
34 Ga0068859_100078013 3300005617 Bacteria 3353
35 Ga0068859_100096992 3300005617 Bacteria 3001
36 Ga0068859_100904245 3300005617 Unclassified 967
37 Ga0068870_10519820 3300005840 Bacteria 796
38 Ga0068863_100133044 3300005841 Bacteria 2375
39 Ga0070717_10010419 3300006028 Bacteria 7019
40 Ga0070712_100153682 3300006175 Bacteria 1769
41 Ga0097621_100286491 3300006237 Bacteria 1451
42 Ga0075428_100429679 3300006844 Bacteria 1415
43 Ga0075428_100781901 3300006844 Unclassified 1015
44 Ga0075428_102123183 3300006844 Unclassified 581
45 Ga0075431_100174318 3300006847 Bacteria 2209
46 Ga0075433_10435392 3300006852 Bacteria 1156
47 Ga0075434_100732006 3300006871 Unclassified 1006
48 Ga0075429_100848237 3300006880 Unclassified 800
49 Ga0097620_100078013 3300006931 Bacteria 3353
50 Ga0097620_100096990 3300006931 Bacteria 3001
51 Ga0097620_100904513 3300006931 Unclassified 967
52 Ga0075435_100337112 3300007076 Bacteria 1292
53 Ga0105240_10000043 3300009093 Bacteria 254256
54 Ga0105240_10214304 3300009093 Bacteria 2248
55 Ga0111539_10302973 3300009094 Bacteria 1860
56 Ga0111539_10489711 3300009094 Bacteria 1432
57 Ga0105245_10168438 3300009098 Bacteria 2084
58 Ga0105245_11188669 3300009098 Unclassified 810
59 Ga0105241_11122678 3300009174 Unclassified 741
60 Ga0105242_10688583 3300009176 Unclassified 999
61 Ga0105248_10128924 3300009177 Bacteria 2854
62 Ga0105239_10034994 3300010375 Bacteria 5516
63 Ga0157378_10023008 3300013297 Bacteria 5486
64 Ga0157378_10645533 3300013297 Unclassified 1074
65 Ga0157378_10825182 3300013297 Bacteria 954
66 Ga0157372_10037397 3300013307 Bacteria 5355
67 Ga0163163_10000064 3300014325 Bacteria 117551
68 Ga0163163_10337831 3300014325 Unclassified 1561
69 Ga0213873_10006647 3300021358 Unclassified 2284
70 Ga0213874_10004756 3300021377 Bacteria 3127
71 Ga0213876_10008710 3300021384 Bacteria 5483
72 Ga0213875_10128697 3300021388 Unclassified 1184
73 Ga0207684_10018162 3300025910 Bacteria 6026
74 Ga0207684_10309706 3300025910 Bacteria 1361
75 Ga0207684_10312194 3300025910 Unclassified 1355
76 Ga0207684_11147636 3300025910 Unclassified 645
77 Ga0207695_10000181 3300025913 Bacteria 185042
78 Ga0207695_10014295 3300025913 Bacteria 9414
79 Ga0207646_10222059 3300025922 Bacteria 1707
80 Ga0207659_10501637 3300025926 Bacteria 1027
81 Ga0207687_10022633 3300025927 Bacteria 4184
82 Ga0207700_10731505 3300025928 Unclassified 884
83 Ga0207664_10162072 3300025929 Bacteria 1908
84 Ga0207686_10167465 3300025934 Bacteria 1546
85 Ga0207670_10003262 3300025936 Bacteria 8602
86 Ga0207670_10014361 3300025936 Unclassified 4700
87 Ga0207670_10639887 3300025936 Bacteria 876
88 Ga0207670_10642572 3300025936 Bacteria 874
89 Ga0207711_10177998 3300025941 Bacteria 1933
90 Ga0207708_10211936 3300026075 Bacteria 1549
91 Ga0207641_10114116 3300026088 Bacteria 2400
92 Ga0207641_10503015 3300026088 Unclassified 1177
93 Ga0207674_10005310 3300026116 Bacteria 15326
94 Ga0207674_10204597 3300026116 Bacteria 1923
95 Ga0207675_100470984 3300026118 Bacteria 1247
96 Ga0265356_1000080 3300028017 Bacteria 15971
97 Ga0265762_1010264 3300030760 Bacteria 1672
98 Ga0265760_10002527 3300031090 Bacteria 5337
99 Ga0265760_10032311 3300031090 Bacteria 1545
100 Ga0265331_10237284 3300031250 Unclassified 819
101 Ga0265327_10008432 3300031251 Bacteria 7675
102 Ga0373945_0228399 3300035116 Bacteria 780
103 Ga0373943_0139013 3300035170 Bacteria 1307
104 Ga0373925_1514760 3300037068 Unclassified 549
105 Ga0436364_0081161 3300037853 Bacteria 3466
106 Ga0436365_1604113 3300039437 Bacteria 49069
107 Ga0436363_0201666 3300039450 Bacteria 2542
108 Ga0436363_1335528 3300039450 Bacteria 1241
109 Ga0436363_1593133 3300039450 Bacteria 6869
110 Ga0436362_0227023 3300039453 Bacteria 5623
111 Ga0451853_0659839 3300041512 Unclassified 719
112 Ga0439459_0160301 3300042438 Bacteria 593
113 Ga0451577_0107355 3300042876 Bacteria 2495
114 Ga0453684_0508313 3300044712 Bacteria 1333
115 Ga0466968_0297707 3300044735 Unclassified 775
116 Ga0466957_0354144 3300044842 Bacteria 996
117 Ga0451576_0089461 3300045051 Bacteria 3202
118 Ga0451576_0482665 3300045051 Bacteria 1302
119 Ga0451576_1258045 3300045051 Unclassified 772
120 Ga0466958_1029855 3300045836 Bacteria 537
121 Ga0466967_0739203 3300045976 Bacteria 975
122 Ga0495641_0034098 3300046461 Unclassified 2409
123 Ga0495653_0355014 3300046463 Bacteria 942
124 Ga0495582_0065382 3300046473 Unclassified 2009
125 Ga0495594_0690874 3300046499 Unclassified 577
126 Ga0495608_0216160 3300046511 Unclassified 1204
127 Ga0495608_0720490 3300046511 Unclassified 593
128 Ga0495618_0284354 3300046514 Unclassified 1031
129 Ga0495628_0280391 3300046516 Bacteria 1238
130 Ga0495628_0649099 3300046516 Unclassified 749
131 Ga0495630_0147636 3300046517 Bacteria 1789
132 Ga0495630_0873939 3300046517 Bacteria 685
133 Ga0495643_0000205 3300046522 Bacteria 91900
134 Ga0495666_0041571 3300046526 Bacteria 2226
135 Ga0495640_0038966 3300046533 Bacteria 3339
136 Ga0495586_0002075 3300046535 Bacteria 10890
137 Ga0495645_0048214 3300046543 Unclassified 3103
138 Ga0495634_0046930 3300046642 Bacteria 2913
139 Ga0495635_0443546 3300046663 Bacteria 859
140 Ga0495647_0057958 3300046681 Bacteria 1521
141 Ga0495658_0000833 3300046683 Bacteria 16564
142 Ga0495658_0429463 3300046683 Bacteria 843
143 Ga0495658_1020739 3300046683 Unclassified 528
144 Ga0495613_0039936 3300046689 Bacteria 3477
145 Ga0495613_0190604 3300046689 Bacteria 1449
146 Ga0495613_0401135 3300046689 Unclassified 935
147 Ga0495624_0246666 3300046690 Bacteria 1080
148 Ga0495680_1020582 3300047322 Unclassified 527
149 Ga0495614_0135816 3300048089 Unclassified 1091
150 Ga0496112_0380840 3300048915 Bacteria 1352
151 Ga0496115_0036329 3300048918 Bacteria 3900
152 Ga0501080_0056137 3300049742 Bacteria 3668
153 nmdc:mga0k408_385827_c1 3300050493 Unclassified 834
154 nmdc:mga09592_416827_c1 3300050508 Bacteria 1160
155 nmdc:mga06r32_87099_c1 3300050510 Bacteria 3047
156 nmdc:mga08y16_446670_c1 3300050511 Bacteria 1319
157 nmdc:mga08y16_70806_c1 3300050511 Bacteria 3634
158 nmdc:mga0n895_414744_c1 3300050512 Unclassified 1361
159 nmdc:mga0rr50_616809_c1 3300050513 Unclassified 925
160 Ga0495601_0118365 3300053077 Bacteria 1719
161 Ga0070697_100592245
162 Ga0065715_10781433
163 Ga0070690_100214365
164 Ga0070690_100245257
165 Ga0070690_100301971
166 Ga0070689_100022569
167 Ga0070689_100033473
168 Ga0070689_100139835
169 Ga0070689_100152650
170 Ga0070687_100948897
171 Ga0070675_100929072
172 Ga0070688_100012087
173 Ga0070688_100032521
174 Ga0070713_100380446
175 Ga0070701_10022220
176 Ga0070705_100043502
177 Ga0070700_100144071
178 Ga0070694_100030926
179 Ga0070694_101616305
180 Ga0070708_100515643
181 Ga0068867_101388117
182 Ga0070706_100164720
183 Ga0070707_100326608
184 Ga0070686_100009820
185 Ga0070686_100106835
186 Ga0070686_100495146
187 Ga0070686_100925352
188 Ga0070695_100214285
189 Ga0070696_100842334
190 Ga0070704_100012442
191 Ga0068857_100067997
192 Ga0068857_100215045
193 Ga0068856_101766458
194 Ga0068859_100078013
195 Ga0068859_100096992
196 Ga0068859_100904245
197 Ga0068870_10519820
198 Ga0068863_100133044
199 Ga0070717_10010419
200 Ga0070712_100153682
201 Ga0097621_100286491
202 Ga0075428_100429679
203 Ga0075428_100781901
204 Ga0075428_102123183
205 Ga0075431_100174318
206 Ga0075433_10435392
207 Ga0075434_100732006
208 Ga0075429_100848237
209 Ga0097620_100078013
210 Ga0097620_100096990
211 Ga0097620_100904513
212 Ga0075435_100337112
213 Ga0105240_10000043
214 Ga0105240_10214304
215 Ga0111539_10302973
216 Ga0111539_10489711
217 Ga0105245_10168438
218 Ga0105245_11188669
219 Ga0105241_11122678
220 Ga0105242_10688583
221 Ga0105248_10128924
222 Ga0105239_10034994
223 Ga0157378_10023008
224 Ga0157378_10645533
225 Ga0157378_10825182
226 Ga0157372_10037397
227 Ga0163163_10000064
228 Ga0163163_10337831
229 Ga0213873_10006647
230 Ga0213874_10004756
231 Ga0213876_10008710
232 Ga0213875_10128697
233 Ga0207684_10018162
234 Ga0207684_10309706
235 Ga0207684_10312194
236 Ga0207684_11147636
237 Ga0207695_10000181
238 Ga0207695_10014295
239 Ga0207646_10222059
240 Ga0207659_10501637
241 Ga0207687_10022633
242 Ga0207700_10731505
243 Ga0207664_10162072
244 Ga0207686_10167465
245 Ga0207670_10003262
246 Ga0207670_10014361
247 Ga0207670_10639887
248 Ga0207670_10642572
249 Ga0207711_10177998
250 Ga0207708_10211936
251 Ga0207641_10114116
252 Ga0207641_10503015
253 Ga0207674_10005310
254 Ga0207674_10204597
255 Ga0207675_100470984
256 Ga0265356_1000080
257 Ga0265762_1010264
258 Ga0265760_10002527
259 Ga0265760_10032311
260 Ga0265331_10237284
261 Ga0265327_10008432
262 Ga0373945_0228399
263 Ga0373943_0139013
264 Ga0373925_1514760
265 Ga0436364_0081161
266 Ga0436365_1604113
267 Ga0436363_0201666
268 Ga0436363_1335528
269 Ga0436363_1593133
270 Ga0436362_0227023
271 Ga0451853_0659839
272 Ga0439459_0160301
273 Ga0451577_0107355
274 Ga0453684_0508313
275 Ga0466968_0297707
276 Ga0466957_0354144
277 Ga0451576_0089461
278 Ga0451576_0482665
279 Ga0451576_1258045
280 Ga0466958_1029855
281 Ga0466967_0739203
282 Ga0495641_0034098
283 Ga0495653_0355014
284 Ga0495582_0065382
285 Ga0495594_0690874
286 Ga0495608_0216160
287 Ga0495608_0720490
288 Ga0495618_0284354
289 Ga0495628_0280391
290 Ga0495628_0649099
291 Ga0495630_0147636
292 Ga0495630_0873939
293 Ga0495643_0000205
294 Ga0495666_0041571
295 Ga0495640_0038966
296 Ga0495586_0002075
297 Ga0495645_0048214
298 Ga0495634_0046930
299 Ga0495635_0443546
300 Ga0495647_0057958
301 Ga0495658_0000833
302 Ga0495658_0429463
303 Ga0495658_1020739
304 Ga0495613_0039936
305 Ga0495613_0190604
306 Ga0495613_0401135
307 Ga0495624_0246666
308 Ga0495680_1020582
309 Ga0495614_0135816
310 Ga0496112_0380840
311 Ga0496115_0036329
312 Ga0501080_0056137
313 nmdc:mga0k408_385827_c1
314 nmdc:mga09592_416827_c1
315 nmdc:mga06r32_87099_c1
316 nmdc:mga08y16_446670_c1
317 nmdc:mga08y16_70806_c1
318 nmdc:mga0n895_414744_c1
319 nmdc:mga0rr50_616809_c1
320 Ga0495601_0118365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

53

124

0.91

PF02311

AraC_binding

AraC-like ligand binding domain

51

129

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.9409 47 122
2b8m-assembly1.cif.gz_A-2 crystal structure of a rmlc-like cupin family protein with a double-stranded beta-helix fold (mj0764) from methanocaldococcus jannaschii at 1.70 a resolution 0.8976 47 122
3h8u-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein with double-stranded beta-helix domain (yp_001338853.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.80 a resolution 0.8952 47 127
3ibm-assembly1.cif.gz_B crystal structure of cupin 2 domain-containing protein hhal_0468 from halorhodospira halophila 0.8939 43 124
7zvy-assembly4.cif.gz_H thermococcus kadokarensis phosphomannose isomerase 0.8921 45 123
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.943 47 123 2.60.120.10
3l2hD01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.935 22 142 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9196 47 124 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9114 47 123 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9101 42 121 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A538NH40-F1-model_v4 Cupin domain-containing protein 0.9882 1 125
AF-A0A2V5MR72-F1-model_v4 Cupin 0.9874 1 124 GO:0046872
AF-A0A2V6KVH9-F1-model_v4 Cupin 0.9828 1 109
AF-A0A7W1KQV2-F1-model_v4 Cupin domain-containing protein 0.9761 1 117
AF-A0A2V6KVH9-F1-model_v4 Cupin 0.974 1 109

Map