F234023

General Info

Members Datasets Scaffolds Average Seq Length
160 104 320 213

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10067192|Ga0070681_100671923
Length 248
Sequence MERFVRATSVPSSSTDSPVPDTVEQPTISVRLGGVALIAGAIAFMAVFSYLAARFNYPAVLDGPADVVLPALLATGGAGRAAWALYGFLPLIWLPAGVGAYYALRRTHPGAMLLALLFASLSAMSMMLGLLRWPTVHWRLAELHAMASPAERRSLAAVFDGLNAFLSFSAFFVLSAWALLHSRRAPRWLALCGLATGLLGWVGMFRNLTGAVAPVAALNNYLLPLWMIAFGVVLMREPRLTSDADRRA

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
76 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
77 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
80 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
81 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
82 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
83 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
87 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
88 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
89 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
90 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
91 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
101 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
102 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
103 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
104 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.25
Rhizosphere 98.75
Stem 0
Stem Tuber 0
Unclassified 26.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10067192 3300005458 Bacteria 3553
2 MBSR1b_contig_1334495 2162886012 Bacteria 1685
3 Ga0065715_10102665 3300005293 Bacteria 3095
4 Ga0070670_100149403 3300005331 Bacteria 2022
5 Ga0070680_100008860 3300005336 Bacteria 7712
6 Ga0070680_100025971 3300005336 Bacteria 4684
7 Ga0070680_100050064 3300005336 Bacteria 3407
8 Ga0070682_100006099 3300005337 Bacteria 6746
9 Ga0070682_100008474 3300005337 Bacteria 5802
10 Ga0070682_100318958 3300005337 Unclassified 1147
11 Ga0068868_100044524 3300005338 Bacteria 3469
12 Ga0070661_100074484 3300005344 Unclassified 2500
13 Ga0070692_10179279 3300005345 Bacteria 1227
14 Ga0070673_100348115 3300005364 Unclassified 1314
15 Ga0070701_10347798 3300005438 Viruses 925
16 Ga0070711_100000715 3300005439 Bacteria 17365
17 Ga0070694_100021598 3300005444 Unclassified 4116
18 Ga0070708_100270404 3300005445 Bacteria 1598
19 Ga0070681_10000473 3300005458 Bacteria 32789
20 Ga0070681_10084371 3300005458 Unclassified 3129
21 Ga0070681_10141636 3300005458 Bacteria 2334
22 Ga0070685_10000624 3300005466 Bacteria 19373
23 Ga0070706_100268181 3300005467 Unclassified 1593
24 Ga0070706_100277446 3300005467 Bacteria 1564
25 Ga0070706_100298131 3300005467 Bacteria 1504
26 Ga0070706_100373931 3300005467 Unclassified 1327
27 Ga0070706_100681879 3300005467 Bacteria 953
28 Ga0070707_100077873 3300005468 Unclassified 3199
29 Ga0070707_100143731 3300005468 Viruses 2322
30 Ga0070707_100645869 3300005468 Bacteria 1021
31 Ga0070698_100067506 3300005471 Bacteria 3596
32 Ga0070698_100091555 3300005471 Unclassified 3023
33 Ga0070698_100162109 3300005471 Unclassified 2180
34 Ga0070699_100006690 3300005518 Bacteria 10026
35 Ga0070679_100030503 3300005530 Bacteria 5323
36 Ga0070679_100036696 3300005530 Bacteria 4865
37 Ga0070679_100778214 3300005530 Unclassified 900
38 Ga0068853_100166108 3300005539 Bacteria 1994
39 Ga0070672_100084545 3300005543 Bacteria 2548
40 Ga0070695_100001010 3300005545 Bacteria 15324
41 Ga0070695_100012712 3300005545 Bacteria 5053
42 Ga0070695_100056221 3300005545 Unclassified 2539
43 Ga0070695_100179151 3300005545 Bacteria 1501
44 Ga0070695_100507930 3300005545 Unclassified 933
45 Ga0070696_100068051 3300005546 Bacteria 2499
46 Ga0070696_100443995 3300005546 Unclassified 1022
47 Ga0070693_100006243 3300005547 Bacteria 5772
48 Ga0070693_100174206 3300005547 Unclassified 1380
49 Ga0070704_100057317 3300005549 Bacteria 2769
50 Ga0068855_100004796 3300005563 Bacteria 16509
51 Ga0070664_100538114 3300005564 Unclassified 1079
52 Ga0068860_100154822 3300005843 Unclassified 2209
53 Ga0097621_100042624 3300006237 Bacteria 3656
54 Ga0068871_100375676 3300006358 Bacteria 1262
55 Ga0075428_100005185 3300006844 Bacteria 14470
56 Ga0075428_100750632 3300006844 Bacteria 1038
57 Ga0075430_100063838 3300006846 Bacteria 3093
58 Ga0075431_100094290 3300006847 Unclassified 3089
59 Ga0075433_10001760 3300006852 Bacteria 16197
60 Ga0075433_10050764 3300006852 Bacteria 3611
61 Ga0075434_100006938 3300006871 Bacteria 10440
62 Ga0075434_100017802 3300006871 Bacteria 6853
63 Ga0075434_100050546 3300006871 Bacteria 4130
64 Ga0075429_100011862 3300006880 Bacteria 7555
65 Ga0075429_100167623 3300006880 Unclassified 1924
66 Ga0075436_100040135 3300006914 Bacteria 3230
67 Ga0075435_100057883 3300007076 Bacteria 3136
68 Ga0105240_10116607 3300009093 Bacteria 3221
69 Ga0111539_10000004 3300009094 Bacteria 751278
70 Ga0111539_10156619 3300009094 Bacteria 2666
71 Ga0105245_10078612 3300009098 Bacteria 3010
72 Ga0105245_10226250 3300009098 Unclassified 1807
73 Ga0114129_10014736 3300009147 Bacteria 11137
74 Ga0114129_10033583 3300009147 Bacteria 7250
75 Ga0114129_10335562 3300009147 Bacteria 2006
76 Ga0114129_10382642 3300009147 Bacteria 1858
77 Ga0105248_10801872 3300009177 Unclassified 1063
78 Ga0105239_10109599 3300010375 Bacteria 3060
79 Ga0157378_10150504 3300013297 Bacteria 2168
80 Ga0163162_10690227 3300013306 Bacteria 1143
81 Ga0157375_10418354 3300013308 Unclassified 1506
82 Ga0157380_11035374 3300014326 Unclassified 856
83 Ga0157376_10214597 3300014969 Bacteria 1779
84 Ga0207653_10033134 3300025885 Bacteria 1674
85 Ga0207699_10030294 3300025906 Bacteria 3026
86 Ga0207684_10180993 3300025910 Unclassified 1818
87 Ga0207684_10298929 3300025910 Bacteria 1388
88 Ga0207707_10099522 3300025912 Unclassified 2541
89 Ga0207707_10113068 3300025912 Bacteria 2373
90 Ga0207707_10125160 3300025912 Unclassified 2248
91 Ga0207695_10086674 3300025913 Bacteria 3157
92 Ga0207663_10000117 3300025916 Bacteria 38399
93 Ga0207660_10014548 3300025917 Bacteria 5177
94 Ga0207660_10044982 3300025917 Unclassified 3108
95 Ga0207652_10024098 3300025921 Bacteria 5047
96 Ga0207652_10118896 3300025921 Unclassified 2350
97 Ga0207652_10251009 3300025921 Bacteria 1595
98 Ga0207646_10057186 3300025922 Unclassified 3485
99 Ga0207646_10294449 3300025922 Unclassified 1466
100 Ga0207687_10257505 3300025927 Bacteria 1390
101 Ga0207644_10039101 3300025931 Unclassified 3347
102 Ga0207677_10288419 3300026023 Unclassified 1350
103 Ga0207639_10046103 3300026041 Bacteria 3287
104 Ga0207648_10271345 3300026089 Unclassified 1515
105 Ga0207648_10332587 3300026089 Bacteria 1367
106 Ga0207428_10000006 3300027907 Bacteria 491716
107 Ga0268264_10428275 3300028381 Bacteria 1277
108 Ga0307405_10238007 3300031731 Bacteria 1346
109 Ga0307413_10003407 3300031824 Bacteria 6685
110 Ga0307413_10456708 3300031824 Bacteria 1015
111 Ga0307410_10079766 3300031852 Bacteria 2295
112 Ga0307410_10243963 3300031852 Unclassified 1393
113 Ga0307407_10041186 3300031903 Bacteria 2581
114 Ga0307407_10311496 3300031903 Bacteria 1101
115 Ga0307409_100011983 3300031995 Bacteria 5501
116 Ga0307409_100128558 3300031995 Bacteria 2160
117 Ga0307409_100613584 3300031995 Bacteria 1077
118 Ga0307416_100814716 3300032002 Bacteria 1030
119 Ga0307414_10152720 3300032004 Bacteria 1824
120 Ga0307411_10005598 3300032005 Bacteria 6191
121 Ga0450898_001005 3300042134 Unclassified 3570
122 Ga0439434_0009434 3300042435 Unclassified 2869
123 Ga0453683_0001765 3300044673 Bacteria 17936
124 Ga0453683_0196644 3300044673 Bacteria 1280
125 Ga0451576_0016804 3300045051 Bacteria 8066
126 Ga0451576_0229093 3300045051 Unclassified 1940
127 Ga0495616_0003969 3300046513 Bacteria 9415
128 Ga0495632_0016799 3300046519 Bacteria 4058
129 Ga0496112_0023405 3300048915 Bacteria 5902
130 Ga0496114_0026734 3300048917 Bacteria 4727
131 Ga0501031_0325048 3300049568 Unclassified 996
132 Ga0501041_0284480 3300049577 Unclassified 1041
133 Ga0501042_0145716 3300049578 Bacteria 1707
134 Ga0501068_0193685 3300049584 Bacteria 1288
135 Ga0501071_0039855 3300049587 Bacteria 3361
136 Ga0501072_0091309 3300049588 Bacteria 2418
137 Ga0501074_0241892 3300049590 Bacteria 1284
138 Ga0501075_0052335 3300049591 Bacteria 3070
139 Ga0501077_0005413 3300049593 Bacteria 7763
140 Ga0501080_0130270 3300049742 Bacteria 2329
141 Ga0501035_0285228 3300049822 Unclassified 1395
142 Ga0501045_0219313 3300049824 Bacteria 1416
143 nmdc:mga05p37_423689_c1 3300050507 Bacteria 1548
144 nmdc:mga09592_63854_c1 3300050508 Bacteria 3117
145 nmdc:mga09592_986217_c1 3300050508 Unclassified 705
146 nmdc:mga06r32_695661_c1 3300050510 Unclassified 983
147 nmdc:mga08y16_290361_c1 3300050511 Bacteria 1686
148 nmdc:mga08y16_5_c1 3300050511 Bacteria 751284
149 nmdc:mga0n895_2262_c1 3300050512 Bacteria 14919
150 nmdc:mga0n895_3216_c1 3300050512 Bacteria 13078
151 nmdc:mga0n895_359_c1 3300050512 Bacteria 30652
152 nmdc:mga0rr50_61822_c1 3300050513 Bacteria 2823
153 nmdc:mga0rr50_62029_c1 3300050513 Bacteria 2819
154 nmdc:mga08x19_49446_c1 3300050514 Bacteria 2696
155 nmdc:mga0a205_13825_c1 3300050515 Bacteria 7522
156 nmdc:mga0a205_1807_c1 3300050515 Bacteria 9602
157 nmdc:mga0a205_241884_c1 3300050515 Bacteria 1686
158 nmdc:mga0a205_582_c1 3300050515 Bacteria 28885
159 Ga0501084_0141312 3300054114 Bacteria 2027
160 Ga0501082_0134268 3300060353 Bacteria 2147
161 Ga0070681_10067192
162 MBSR1b_contig_1334495
163 Ga0065715_10102665
164 Ga0070670_100149403
165 Ga0070680_100008860
166 Ga0070680_100025971
167 Ga0070680_100050064
168 Ga0070682_100006099
169 Ga0070682_100008474
170 Ga0070682_100318958
171 Ga0068868_100044524
172 Ga0070661_100074484
173 Ga0070692_10179279
174 Ga0070673_100348115
175 Ga0070701_10347798
176 Ga0070711_100000715
177 Ga0070694_100021598
178 Ga0070708_100270404
179 Ga0070681_10000473
180 Ga0070681_10084371
181 Ga0070681_10141636
182 Ga0070685_10000624
183 Ga0070706_100268181
184 Ga0070706_100277446
185 Ga0070706_100298131
186 Ga0070706_100373931
187 Ga0070706_100681879
188 Ga0070707_100077873
189 Ga0070707_100143731
190 Ga0070707_100645869
191 Ga0070698_100067506
192 Ga0070698_100091555
193 Ga0070698_100162109
194 Ga0070699_100006690
195 Ga0070679_100030503
196 Ga0070679_100036696
197 Ga0070679_100778214
198 Ga0068853_100166108
199 Ga0070672_100084545
200 Ga0070695_100001010
201 Ga0070695_100012712
202 Ga0070695_100056221
203 Ga0070695_100179151
204 Ga0070695_100507930
205 Ga0070696_100068051
206 Ga0070696_100443995
207 Ga0070693_100006243
208 Ga0070693_100174206
209 Ga0070704_100057317
210 Ga0068855_100004796
211 Ga0070664_100538114
212 Ga0068860_100154822
213 Ga0097621_100042624
214 Ga0068871_100375676
215 Ga0075428_100005185
216 Ga0075428_100750632
217 Ga0075430_100063838
218 Ga0075431_100094290
219 Ga0075433_10001760
220 Ga0075433_10050764
221 Ga0075434_100006938
222 Ga0075434_100017802
223 Ga0075434_100050546
224 Ga0075429_100011862
225 Ga0075429_100167623
226 Ga0075436_100040135
227 Ga0075435_100057883
228 Ga0105240_10116607
229 Ga0111539_10000004
230 Ga0111539_10156619
231 Ga0105245_10078612
232 Ga0105245_10226250
233 Ga0114129_10014736
234 Ga0114129_10033583
235 Ga0114129_10335562
236 Ga0114129_10382642
237 Ga0105248_10801872
238 Ga0105239_10109599
239 Ga0157378_10150504
240 Ga0163162_10690227
241 Ga0157375_10418354
242 Ga0157380_11035374
243 Ga0157376_10214597
244 Ga0207653_10033134
245 Ga0207699_10030294
246 Ga0207684_10180993
247 Ga0207684_10298929
248 Ga0207707_10099522
249 Ga0207707_10113068
250 Ga0207707_10125160
251 Ga0207695_10086674
252 Ga0207663_10000117
253 Ga0207660_10014548
254 Ga0207660_10044982
255 Ga0207652_10024098
256 Ga0207652_10118896
257 Ga0207652_10251009
258 Ga0207646_10057186
259 Ga0207646_10294449
260 Ga0207687_10257505
261 Ga0207644_10039101
262 Ga0207677_10288419
263 Ga0207639_10046103
264 Ga0207648_10271345
265 Ga0207648_10332587
266 Ga0207428_10000006
267 Ga0268264_10428275
268 Ga0307405_10238007
269 Ga0307413_10003407
270 Ga0307413_10456708
271 Ga0307410_10079766
272 Ga0307410_10243963
273 Ga0307407_10041186
274 Ga0307407_10311496
275 Ga0307409_100011983
276 Ga0307409_100128558
277 Ga0307409_100613584
278 Ga0307416_100814716
279 Ga0307414_10152720
280 Ga0307411_10005598
281 Ga0450898_001005
282 Ga0439434_0009434
283 Ga0453683_0001765
284 Ga0453683_0196644
285 Ga0451576_0016804
286 Ga0451576_0229093
287 Ga0495616_0003969
288 Ga0495632_0016799
289 Ga0496112_0023405
290 Ga0496114_0026734
291 Ga0501031_0325048
292 Ga0501041_0284480
293 Ga0501042_0145716
294 Ga0501068_0193685
295 Ga0501071_0039855
296 Ga0501072_0091309
297 Ga0501074_0241892
298 Ga0501075_0052335
299 Ga0501077_0005413
300 Ga0501080_0130270
301 Ga0501035_0285228
302 Ga0501045_0219313
303 nmdc:mga05p37_423689_c1
304 nmdc:mga09592_63854_c1
305 nmdc:mga09592_986217_c1
306 nmdc:mga06r32_695661_c1
307 nmdc:mga08y16_290361_c1
308 nmdc:mga08y16_5_c1
309 nmdc:mga0n895_2262_c1
310 nmdc:mga0n895_3216_c1
311 nmdc:mga0n895_359_c1
312 nmdc:mga0rr50_61822_c1
313 nmdc:mga0rr50_62029_c1
314 nmdc:mga08x19_49446_c1
315 nmdc:mga0a205_13825_c1
316 nmdc:mga0a205_1807_c1
317 nmdc:mga0a205_241884_c1
318 nmdc:mga0a205_582_c1
319 Ga0501084_0141312
320 Ga0501082_0134268

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14329

DUF4386

Domain of unknown function (DUF4386)

32

234

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tkg-assembly1.cif.gz_5 yeast atp synthase state 2catalytic(a) with 10 mm atp backbone model 0.632 28 95
7tkg-assembly1.cif.gz_5 yeast atp synthase state 2catalytic(a) with 10 mm atp backbone model 0.5833 28 95
7tk4-assembly1.cif.gz_2 yeast atp synthase state 1binding(c) with 10 mm atp backbone model 0.5767 28 95
7tk4-assembly1.cif.gz_2 yeast atp synthase state 1binding(c) with 10 mm atp backbone model 0.5336 28 95
2fic-assembly2.cif.gz_A the crystal structure of the bar domain from human bin1/amphiphysin ii and its implications for molecular recognition 0.4441 12 121
ID Description Score Start End Superfamily
1yceb01 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.6155 28 93 1.20.20.10
2wgmH01 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.6139 28 93 1.20.20.10
af_G2J646_1_138_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.538 3 103 1.20.140.150
af_Q9VEF5_13_115_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.5359 8 114 1.10.287.1060
3zk2P01 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.5318 28 98 1.20.20.10
ID Description Score Start End GO Terms
AF-A0A0K8P0H9-F1-model_v4 DUF4386 family protein 0.7088 2 165 GO:0016020
AF-A0A535SM05-F1-model_v4 DUF4386 family protein 0.7049 1 165 GO:0016020
AF-A0A7W0U703-F1-model_v4 DUF4386 domain-containing protein 0.7031 5 142 GO:0016020
AF-A0A4R8XTG3-F1-model_v4 deleted 0.6949 5 146
AF-A0A849SGL9-F1-model_v4 DUF4386 family protein 0.6938 2 164 GO:0016020

Map