F233342

General Info

Members Datasets Scaffolds Average Seq Length
159 147 318 123

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2791355197|2793071130
Length 137
Sequence EREGGMKSAITTGVCRLGRLVAAVFVVATSSAWAGDQGDGEQSCDGSTYQMVECLKAKTAQWDKRMNVAYQQALKDAAGDKQRDQLRTAQRLWIQYRDANCLYYDLGEGTIARLDAGECMRSMTEARAKELENLGHQ

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
15 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
25 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
37 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
38 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
53 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
54 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
55 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
56 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
57 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
58 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
63 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
64 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
65 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
66 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
68 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
69 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
70 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
71 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
72 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
73 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
78 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
81 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
82 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
83 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
84 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
85 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
86 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
91 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
94 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
95 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
96 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
97 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
98 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
99 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
107 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
108 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
109 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
112 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
113 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
114 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
115 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
116 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
117 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
118 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
119 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
120 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
121 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
122 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
123 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
124 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
125 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
126 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
127 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
128 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
129 2791355199
130 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
131 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
132 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
133 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
134 2904699407
135 2906610324
136 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
137 2922425934
138 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
139 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
140 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
141 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
142 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
143 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
144 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
145 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
146 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
147 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.81
Metatranscriptomes 0
Isolates 14.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.43
Nodule 10.69
Rhizoplane 6.92
Rhizosphere 59.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1023965 3300003214 Bacteria 793
2 Ga0065715_10248931 3300005293 Bacteria 1140
3 Ga0070670_101165948 3300005331 Bacteria 704
4 Ga0070680_100366001 3300005336 Bacteria 1226
5 Ga0070682_100013375 3300005337 Bacteria 4719
6 Ga0070671_101212747 3300005355 Bacteria 664
7 Ga0070671_101994600 3300005355 Bacteria 516
8 Ga0070709_10955180 3300005434 Bacteria 680
9 Ga0068853_100167788 3300005539 Bacteria 1985
10 Ga0070686_101676619 3300005544 Bacteria 539
11 Ga0070665_100010632 3300005548 Bacteria 9314
12 Ga0068854_100361601 3300005578 Bacteria 1191
13 Ga0068852_101047959 3300005616 Bacteria 835
14 Ga0068859_101213681 3300005617 Bacteria 831
15 Ga0068866_10334690 3300005718 Bacteria 957
16 Ga0068851_10521222 3300005834 Bacteria 715
17 Ga0068860_100605011 3300005843 Bacteria 1102
18 Ga0081455_10383843 3300005937 Bacteria 980
19 Ga0081540_1002562 3300005983 Bacteria 14747
20 Ga0075364_10202506 3300006051 Bacteria 1346
21 Ga0070712_100837447 3300006175 Bacteria 791
22 Ga0075367_10726281 3300006178 Bacteria 632
23 Ga0068865_100146571 3300006881 Bacteria 1786
24 Ga0097620_101213477 3300006931 Bacteria 831
25 Ga0099794_10081000 3300007265 Bacteria 1601
26 Ga0099795_10107162 3300007788 Bacteria 1103
27 Ga0105245_10881676 3300009098 Bacteria 936
28 Ga0105247_11339943 3300009101 Bacteria 576
29 Ga0105241_10495926 3300009174 Bacteria 1088
30 Ga0105241_10551122 3300009174 Bacteria 1035
31 Ga0105238_10309446 3300009551 Bacteria 1564
32 Ga0099796_10298293 3300010159 Bacteria 682
33 Ga0105239_10172570 3300010375 Bacteria 2418
34 Ga0105239_10784872 3300010375 Bacteria 1091
35 Ga0105239_11069277 3300010375 Bacteria 928
36 Ga0105246_10977856 3300011119 Bacteria 765
37 Ga0157374_11670727 3300013296 Bacteria 661
38 Ga0157375_10499541 3300013308 Bacteria 1380
39 Ga0157376_10752253 3300014969 Bacteria 984
40 Ga0209233_1010499 3300025261 Bacteria 2772
41 Ga0209758_1009213 3300025297 Bacteria 6196
42 Ga0207692_10135263 3300025898 Bacteria 1396
43 Ga0207680_10128201 3300025903 Bacteria 1669
44 Ga0207647_10568205 3300025904 Bacteria 628
45 Ga0207699_11004379 3300025906 Bacteria 617
46 Ga0207693_10073978 3300025915 Bacteria 2668
47 Ga0207687_10721480 3300025927 Bacteria 847
48 Ga0207644_10679481 3300025931 Bacteria 858
49 Ga0207665_11023065 3300025939 Bacteria 658
50 Ga0207640_10051943 3300025981 Bacteria 2667
51 Ga0207703_10551943 3300026035 Bacteria 1086
52 Ga0207639_10063763 3300026041 Bacteria 2855
53 Ga0207641_10094672 3300026088 Bacteria 2620
54 Ga0207648_10331892 3300026089 Bacteria 1368
55 Ga0268266_10061334 3300028379 Bacteria 3243
56 Ga0307517_10000085 3300028786 Bacteria 131200
57 Ga0307517_10157464 3300028786 Bacteria 1536
58 Ga0265330_10101780 3300031235 Bacteria 1229
59 Ga0265325_10027267 3300031241 Bacteria 3089
60 Ga0265329_10180929 3300031242 Bacteria 690
61 Ga0265340_10009829 3300031247 Bacteria 5124
62 Ga0265331_10018352 3300031250 Bacteria 3631
63 Ga0307509_10775092 3300031507 Bacteria 624
64 Ga0307408_100627492 3300031548 Bacteria 958
65 Ga0265314_10000771 3300031711 Bacteria 38181
66 Ga0307510_10134712 3300033180 Bacteria 2132
67 Ga0307510_10457660 3300033180 Bacteria 717
68 Ga0315911_1000010 3300033442 Bacteria 322197
69 Ga0373934_0068704 3300035086 Bacteria 1415
70 Ga0373949_0205700 3300035090 Bacteria 593
71 Ga0373951_0013454 3300035091 Bacteria 1840
72 Ga0373923_0583759 3300035111 Bacteria 549
73 Ga0373936_0076547 3300035113 Bacteria 1387
74 Ga0373931_0017054 3300035691 Bacteria 3583
75 Ga0436361_0387831 3300039447 Bacteria 547
76 Ga0451793_1658455 3300041452 Bacteria 507
77 Ga0451843_1389462 3300041509 Bacteria 549
78 Ga0439459_0024014 3300042438 Bacteria 1193
79 Ga0495603_0132254 3300046455 Bacteria 1452
80 Ga0495629_0002258 3300046459 Bacteria 14852
81 Ga0495629_0101341 3300046459 Bacteria 2009
82 Ga0495629_0241479 3300046459 Bacteria 1244
83 Ga0495651_0085487 3300046462 Bacteria 2375
84 Ga0495651_0171557 3300046462 Bacteria 1544
85 Ga0495662_0538872 3300046476 Bacteria 572
86 Ga0495594_0477925 3300046499 Bacteria 708
87 Ga0495596_0115996 3300046500 Bacteria 1040
88 Ga0495608_0246562 3300046511 Bacteria 1115
89 Ga0495620_0117162 3300046515 Bacteria 1052
90 Ga0495643_0171445 3300046522 Bacteria 1061
91 Ga0495654_0308979 3300046530 Bacteria 644
92 Ga0495622_0086390 3300046557 Bacteria 1442
93 Ga0495667_0251034 3300046559 Bacteria 1126
94 Ga0495656_0282453 3300046615 Bacteria 846
95 Ga0495668_0738784 3300046616 Bacteria 545
96 Ga0495634_0081251 3300046642 Bacteria 2120
97 Ga0495611_0567164 3300046648 Bacteria 514
98 Ga0495635_0217737 3300046663 Bacteria 1292
99 Ga0495588_0380070 3300046674 Bacteria 742
100 Ga0495623_0418019 3300046679 Bacteria 719
101 Ga0495613_0178946 3300046689 Bacteria 1502
102 Ga0495670_0477466 3300046691 Bacteria 676
103 Ga0495581_0074371 3300047315 Bacteria 1966
104 Ga0495672_0014045 3300047320 Bacteria 5500
105 Ga0495686_0633867 3300047472 Bacteria 551
106 Ga0495593_0182490 3300047673 Bacteria 1057
107 Ga0495602_1065655 3300048088 Bacteria 531
108 Ga0496100_0428419 3300048903 Bacteria 1011
109 Ga0496101_0708920 3300048904 Bacteria 794
110 Ga0496102_0052186 3300048905 Bacteria 3725
111 Ga0496102_1423787 3300048905 Bacteria 612
112 Ga0496108_0583616 3300048911 Bacteria 974
113 Ga0496112_0271951 3300048915 Bacteria 1642
114 Ga0496112_1073713 3300048915 Bacteria 724
115 Ga0496113_0009715 3300048916 Bacteria 6321
116 Ga0496115_1164147 3300048918 Bacteria 581
117 Ga0496118_0256566 3300048921 Bacteria 990
118 Ga0496120_0048159 3300048923 Bacteria 2454
119 Ga0496121_0052066 3300048924 Bacteria 3442
120 Ga0496125_0426532 3300048928 Bacteria 767
121 Ga0496126_0341104 3300048929 Bacteria 1227
122 Ga0496126_1244439 3300048929 Bacteria 545
123 nmdc:mga00v17_1050297_c1 3300050491 Bacteria 511
124 Ga0495655_0165020 3300053083 Bacteria 705
125 Ga0500581_311689 3300053089 Bacteria 619
126 Ga0500646_0018274 3300053090 Bacteria 1845
127 Ga0500583_0099937 3300053092 Bacteria 1420
128 Ga0500651_0351430 3300053093 Bacteria 836
129 Ga0500566_0014368 3300053094 Bacteria 4655
130 Ga0500554_206421 3300053102 Bacteria 656
131 Ga0500559_0002465 3300053136 Bacteria 9560
132 Ga0500590_016290 3300053148 Bacteria 3844
133 Ga0500661_011282 3300055283 Bacteria 1617
134 2793071130 2791355197 Bacteria 8420563
135 2513654941 2513237096 Bacteria 8722461
136 2513861263 2513237137 Bacteria 9558895
137 2513916036 2513237145 Bacteria 8979722
138 2524534400 2524023228 Bacteria 10118060
139 2643755239 2643221547 Bacteria 4740017
140 2671119082 2667528175 Bacteria 7532676
141 2793083134
142 2885379343 2885374607 Bacteria 8927485
143 2889033539 2889033259 Bacteria 9099371
144 2893071056 2893066018 Bacteria 6158120
145 2903758043 2903748898 Bacteria 9972761
146 2904705693
147 2906611387
148 2908744973 2908739725 Bacteria 8628932
149 2922427981
150 2935632101 2935630451 Bacteria 8169952
151 2941508049 2941507105 Bacteria 8166816
152 2941515446 2941515067 Bacteria 8166720
153 2941523979 2941523033 Bacteria 8169134
154 3005477688 3005474847 Bacteria 9259049
155 8006933530 8006933436 Bacteria 10410654
156 8006971321 8006964411 Bacteria 8966052
157 8006983203 8006973647 Bacteria 10679141
158 8019559454 8019555841 Bacteria 9642137
159 8019569553 8019565922 Bacteria 9639779
160 JGI25165J46597_1023965
161 Ga0065715_10248931
162 Ga0070670_101165948
163 Ga0070680_100366001
164 Ga0070682_100013375
165 Ga0070671_101212747
166 Ga0070671_101994600
167 Ga0070709_10955180
168 Ga0068853_100167788
169 Ga0070686_101676619
170 Ga0070665_100010632
171 Ga0068854_100361601
172 Ga0068852_101047959
173 Ga0068859_101213681
174 Ga0068866_10334690
175 Ga0068851_10521222
176 Ga0068860_100605011
177 Ga0081455_10383843
178 Ga0081540_1002562
179 Ga0075364_10202506
180 Ga0070712_100837447
181 Ga0075367_10726281
182 Ga0068865_100146571
183 Ga0097620_101213477
184 Ga0099794_10081000
185 Ga0099795_10107162
186 Ga0105245_10881676
187 Ga0105247_11339943
188 Ga0105241_10495926
189 Ga0105241_10551122
190 Ga0105238_10309446
191 Ga0099796_10298293
192 Ga0105239_10172570
193 Ga0105239_10784872
194 Ga0105239_11069277
195 Ga0105246_10977856
196 Ga0157374_11670727
197 Ga0157375_10499541
198 Ga0157376_10752253
199 Ga0209233_1010499
200 Ga0209758_1009213
201 Ga0207692_10135263
202 Ga0207680_10128201
203 Ga0207647_10568205
204 Ga0207699_11004379
205 Ga0207693_10073978
206 Ga0207687_10721480
207 Ga0207644_10679481
208 Ga0207665_11023065
209 Ga0207640_10051943
210 Ga0207703_10551943
211 Ga0207639_10063763
212 Ga0207641_10094672
213 Ga0207648_10331892
214 Ga0268266_10061334
215 Ga0307517_10000085
216 Ga0307517_10157464
217 Ga0265330_10101780
218 Ga0265325_10027267
219 Ga0265329_10180929
220 Ga0265340_10009829
221 Ga0265331_10018352
222 Ga0307509_10775092
223 Ga0307408_100627492
224 Ga0265314_10000771
225 Ga0307510_10134712
226 Ga0307510_10457660
227 Ga0315911_1000010
228 Ga0373934_0068704
229 Ga0373949_0205700
230 Ga0373951_0013454
231 Ga0373923_0583759
232 Ga0373936_0076547
233 Ga0373931_0017054
234 Ga0436361_0387831
235 Ga0451793_1658455
236 Ga0451843_1389462
237 Ga0439459_0024014
238 Ga0495603_0132254
239 Ga0495629_0002258
240 Ga0495629_0101341
241 Ga0495629_0241479
242 Ga0495651_0085487
243 Ga0495651_0171557
244 Ga0495662_0538872
245 Ga0495594_0477925
246 Ga0495596_0115996
247 Ga0495608_0246562
248 Ga0495620_0117162
249 Ga0495643_0171445
250 Ga0495654_0308979
251 Ga0495622_0086390
252 Ga0495667_0251034
253 Ga0495656_0282453
254 Ga0495668_0738784
255 Ga0495634_0081251
256 Ga0495611_0567164
257 Ga0495635_0217737
258 Ga0495588_0380070
259 Ga0495623_0418019
260 Ga0495613_0178946
261 Ga0495670_0477466
262 Ga0495581_0074371
263 Ga0495672_0014045
264 Ga0495686_0633867
265 Ga0495593_0182490
266 Ga0495602_1065655
267 Ga0496100_0428419
268 Ga0496101_0708920
269 Ga0496102_0052186
270 Ga0496102_1423787
271 Ga0496108_0583616
272 Ga0496112_0271951
273 Ga0496112_1073713
274 Ga0496113_0009715
275 Ga0496115_1164147
276 Ga0496118_0256566
277 Ga0496120_0048159
278 Ga0496121_0052066
279 Ga0496125_0426532
280 Ga0496126_0341104
281 Ga0496126_1244439
282 nmdc:mga00v17_1050297_c1
283 Ga0495655_0165020
284 Ga0500581_311689
285 Ga0500646_0018274
286 Ga0500583_0099937
287 Ga0500651_0351430
288 Ga0500566_0014368
289 Ga0500554_206421
290 Ga0500559_0002465
291 Ga0500590_016290
292 Ga0500661_011282
293 2793071130
294 2513654941
295 2513861263
296 2513916036
297 2524534400
298 2643755239
299 2671119082
300 2793083134
301 2885379343
302 2889033539
303 2893071056
304 2903758043
305 2904705693
306 2906611387
307 2908744973
308 2922427981
309 2935632101
310 2941508049
311 2941515446
312 2941523979
313 3005477688
314 8006933530
315 8006971321
316 8006983203
317 8019559454
318 8019569553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07007

LprI

Lysozyme inhibitor LprI

39

131

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ar7-assembly4.cif.gz_D crystal structure of a putative uncharacterized protein from burkholderia thailandensis 0.7845 41 130
3gi7-assembly1.cif.gz_A crystal structure of a duf1311 family protein (pp0307) from pseudomonas putida kt2440 at 1.85 a resolution 0.7676 39 131
3gi7-assembly1.cif.gz_A crystal structure of a duf1311 family protein (pp0307) from pseudomonas putida kt2440 at 1.85 a resolution 0.6939 39 131
4noo-assembly1.cif.gz_B molecular mechanism for self-protection against type vi secretion system in vibrio cholerae 0.6399 42 128
7jzn-assembly1.cif.gz_E sars-cov-2 spike in complex with lcb3 (2rbds open) 0.5894 53 131
ID Description Score Start End Superfamily
3gi7B00 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.781 43 131 1.20.1270.180
af_P76296_30_158_1.20.1270.180 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.7617 31 126 1.20.1270.180
3gi7B00 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.723 43 131 1.20.1270.180
4nsrD00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.6576 39 128 1.10.8.1160
4nsrB00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.6123 40 131 1.10.8.1160
ID Description Score Start End GO Terms
AF-A0A1G5T5R7-F1-model_v4 Uncharacterized conserved protein YecT, DUF1311 family 0.9342 39 130
AF-A0A5D3KA71-F1-model_v4 DUF1311 domain-containing protein 0.9293 46 129
AF-A0A537SWT8-F1-model_v4 DUF1311 domain-containing protein 0.921 42 131
AF-A0A482U1B0-F1-model_v4 DUF1311 domain-containing protein 0.9192 42 130
AF-A0A3A8FD15-F1-model_v4 DUF1311 domain-containing protein 0.9136 42 127

Map