F233191

General Info

Members Datasets Scaffolds Average Seq Length
159 73 159 335

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0139230|Ga0501070_0139230_249_1310
Length 353
Sequence VFSPLRFRRVFVAIPPMPRKHDDEPEAPKKISSYTVKLDDAQMEKLRSILVARGWTPFEVGYTRFAFKADHLKVNVSAYTSGKVVVAGKGTEDFVRDVIEPEVTGAAKLGYDEVLHPDWFESHAGLDESGKGDFFGPVIAATVIADKPAIEAWIKAGVKDSKKIAELQIGRLDKIIRETKGAVVEVCYCHTMARYNELMARPNANLNRLLAWQHATALTGALAKKPVRWGLLDQFSEQPLTQRELARKGVADFELKMRTKAEEDPVVAAASVVARAEFVRQMHALSKRFGAKLQKGAGPLVKEQAAQIIQKFGARALGDFAKLHFRTAYEVVAAAGKLDELPLPEPKARVEWE

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
9 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
10 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
11 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
12 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
20 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
21 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
22 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
23 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
24 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
25 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
26 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
27 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
28 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
29 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
30 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
31 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
32 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
33 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
34 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
35 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
36 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
37 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
38 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
39 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
40 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
41 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
42 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
43 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
44 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
48 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
49 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
50 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
51 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
52 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
53 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
54 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
55 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
56 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
58 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
68 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
69 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
70 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
73 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 0
Rhizosphere 96.23
Stem 0
Stem Tuber 0
Unclassified 3.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10030129 3300003320 Bacteria 1586
2 rootL2_10040216 3300003322 Bacteria 1440
3 rootL2_10213016 3300003322 Bacteria 2070
4 rootH1_10311251 3300003323 Bacteria 2879
5 Ga0070658_10049189 3300005327 Bacteria 3415
6 Ga0068869_100000032 3300005334 Bacteria 58379
7 Ga0070713_100011079 3300005436 Bacteria 6548
8 Ga0068856_100017437 3300005614 Bacteria 6957
9 Ga0097621_100050598 3300006237 Bacteria 3379
10 Ga0068871_100013226 3300006358 Bacteria 6121
11 Ga0068865_100002429 3300006881 Bacteria 11011
12 Ga0163163_10099884 3300014325 Bacteria 2923
13 Ga0207705_10073222 3300025909 Bacteria 2485
14 Ga0207700_10003744 3300025928 Bacteria 8880
15 Ga0207704_10044273 3300025938 Bacteria 2636
16 Ga0207689_10000932 3300025942 Bacteria 28064
17 Ga0207661_10027368 3300025944 Bacteria 4355
18 Ga0207661_10030531 3300025944 Bacteria 4153
19 Ga0207639_10204537 3300026041 Bacteria 1696
20 Ga0207648_10001776 3300026089 Bacteria 23622
21 Ga0265337_1000519 3300028556 Bacteria 20390
22 Ga0265337_1031734 3300028556 Bacteria 1566
23 Ga0265326_10015740 3300028558 Bacteria 2191
24 Ga0265326_10030931 3300028558 Bacteria 1525
25 Ga0265319_1000050 3300028563 Bacteria 97690
26 Ga0265319_1000881 3300028563 Bacteria 19040
27 Ga0265319_1017148 3300028563 Bacteria 2759
28 Ga0265319_1046902 3300028563 Bacteria 1439
29 Ga0265319_1049299 3300028563 Bacteria 1395
30 Ga0265334_10001557 3300028573 Bacteria 11043
31 Ga0265334_10004713 3300028573 Bacteria 6005
32 Ga0265334_10050844 3300028573 Bacteria 1591
33 Ga0265318_10000047 3300028577 Bacteria 123944
34 Ga0265318_10000522 3300028577 Bacteria 27615
35 Ga0265318_10001186 3300028577 Bacteria 16021
36 Ga0265318_10002019 3300028577 Bacteria 11231
37 Ga0265318_10006645 3300028577 Bacteria 5306
38 Ga0265318_10013368 3300028577 Bacteria 3471
39 Ga0265323_10000076 3300028653 Bacteria 55887
40 Ga0265323_10001322 3300028653 Bacteria 12308
41 Ga0265323_10002818 3300028653 Bacteria 7828
42 Ga0265323_10006389 3300028653 Bacteria 4957
43 Ga0265323_10014487 3300028653 Bacteria 3122
44 Ga0265323_10026367 3300028653 Bacteria 2191
45 Ga0265322_10000399 3300028654 Bacteria 17926
46 Ga0265322_10001481 3300028654 Bacteria 7631
47 Ga0265336_10000521 3300028666 Bacteria 22232
48 Ga0265336_10020322 3300028666 Bacteria 2132
49 Ga0265338_10000339 3300028800 Bacteria 85119
50 Ga0265338_10009289 3300028800 Bacteria 11756
51 Ga0265324_10004515 3300029957 Bacteria 6250
52 Ga0265324_10015359 3300029957 Bacteria 2817
53 Ga0265324_10052890 3300029957 Bacteria 1395
54 Ga0265330_10007900 3300031235 Bacteria 5155
55 Ga0265330_10031326 3300031235 Bacteria 2384
56 Ga0265332_10046982 3300031238 Bacteria 1859
57 Ga0265320_10001455 3300031240 Bacteria 17276
58 Ga0265320_10002113 3300031240 Bacteria 13966
59 Ga0265320_10002186 3300031240 Bacteria 13753
60 Ga0265320_10004051 3300031240 Bacteria 9636
61 Ga0265320_10004225 3300031240 Bacteria 9436
62 Ga0265320_10006661 3300031240 Bacteria 7257
63 Ga0265320_10007659 3300031240 Bacteria 6680
64 Ga0265320_10007843 3300031240 Bacteria 6592
65 Ga0265320_10008226 3300031240 Bacteria 6402
66 Ga0265320_10016028 3300031240 Bacteria 4213
67 Ga0265320_10055363 3300031240 Bacteria 1909
68 Ga0265325_10009672 3300031241 Bacteria 5621
69 Ga0265339_10072187 3300031249 Bacteria 1837
70 Ga0265331_10015765 3300031250 Bacteria 3982
71 Ga0265331_10029617 3300031250 Bacteria 2730
72 Ga0265331_10067048 3300031250 Bacteria 1684
73 Ga0265327_10000325 3300031251 Bacteria 90949
74 Ga0265327_10001875 3300031251 Bacteria 24315
75 Ga0265327_10002019 3300031251 Bacteria 22908
76 Ga0265327_10009244 3300031251 Bacteria 7146
77 Ga0265327_10114079 3300031251 Bacteria 1287
78 Ga0265316_10004508 3300031344 Bacteria 13844
79 Ga0265316_10007866 3300031344 Bacteria 9976
80 Ga0265316_10010449 3300031344 Bacteria 8457
81 Ga0265316_10013083 3300031344 Bacteria 7400
82 Ga0265316_10027355 3300031344 Bacteria 4723
83 Ga0265316_10072941 3300031344 Unclassified 2644
84 Ga0265316_10088737 3300031344 Bacteria 2361
85 Ga0265316_10137625 3300031344 Bacteria 1837
86 Ga0307408_100000003 3300031548 Bacteria 618438
87 Ga0265313_10000165 3300031595 Bacteria 69129
88 Ga0265313_10001031 3300031595 Bacteria 27090
89 Ga0265313_10001557 3300031595 Bacteria 21281
90 Ga0265313_10002748 3300031595 Bacteria 14842
91 Ga0265313_10008030 3300031595 Bacteria 7075
92 Ga0265313_10017703 3300031595 Bacteria 4032
93 Ga0265313_10056341 3300031595 Bacteria 1859
94 Ga0307508_10000006 3300031616 Bacteria 275479
95 Ga0265314_10001982 3300031711 Bacteria 21748
96 Ga0265314_10005480 3300031711 Bacteria 11442
97 Ga0265314_10014596 3300031711 Bacteria 6271
98 Ga0265314_10015508 3300031711 Bacteria 6046
99 Ga0265314_10022053 3300031711 Bacteria 4883
100 Ga0265342_10003248 3300031712 Bacteria 13476
101 Ga0265342_10055270 3300031712 Bacteria 2357
102 Ga0265342_10073076 3300031712 Bacteria 1995
103 Ga0265342_10180710 3300031712 Bacteria 1155
104 Ga0307410_10000002 3300031852 Bacteria 145309
105 Ga0307407_10105879 3300031903 Bacteria 1755
106 Ga0307412_10020611 3300031911 Bacteria 4015
107 Ga0307409_100000025 3300031995 Bacteria 51516
108 Ga0307416_100000012 3300032002 Bacteria 296814
109 Ga0373951_0033545 3300035091 Unclassified 1217
110 Ga0373960_0049012 3300035121 Bacteria 1248
111 Ga0395905_0000010 3300037471 Bacteria 460729
112 Ga0439445_0030864 3300042004 Bacteria 1390
113 Ga0451577_0000087 3300042876 Bacteria 207662
114 Ga0451577_0003447 3300042876 Bacteria 17610
115 Ga0451577_0028977 3300042876 Bacteria 5007
116 Ga0453683_0000948 3300044673 Bacteria 27649
117 Ga0453683_0031400 3300044673 Bacteria 3357
118 Ga0453684_0000001 3300044712 Bacteria 2623166
119 Ga0453684_0027192 3300044712 Bacteria 8215
120 Ga0453684_0122107 3300044712 Bacteria 3143
121 Ga0453684_0439276 3300044712 Bacteria 1454
122 Ga0451576_0000071 3300045051 Bacteria 258795
123 Ga0451576_0001527 3300045051 Bacteria 38964
124 Ga0451576_0002156 3300045051 Bacteria 30456
125 Ga0451576_0003954 3300045051 Bacteria 19756
126 Ga0451576_0031566 3300045051 Bacteria 5646
127 Ga0451576_0542482 3300045051 Bacteria 1222
128 Ga0495598_0070128 3300046537 Bacteria 1102
129 Ga0501031_0037693 3300049568 Bacteria 3155
130 Ga0501032_0000292 3300049569 Bacteria 42003
131 Ga0501032_0027549 3300049569 Bacteria 3904
132 Ga0501032_0041752 3300049569 Bacteria 3114
133 Ga0501033_0000870 3300049570 Bacteria 27610
134 Ga0501033_0016866 3300049570 Bacteria 5521
135 Ga0501034_0041759 3300049571 Bacteria 4641
136 Ga0501034_0101260 3300049571 Bacteria 2874
137 Ga0501037_0038145 3300049573 Bacteria 3541
138 Ga0501037_0046399 3300049573 Bacteria 3186
139 Ga0501038_0020048 3300049574 Bacteria 6018
140 Ga0501039_0043359 3300049575 Bacteria 3475
141 Ga0501043_0128055 3300049579 Unclassified 1990
142 Ga0501046_0001449 3300049580 Bacteria 22829
143 Ga0501046_0161082 3300049580 Unclassified 1687
144 Ga0501047_0066542 3300049581 Bacteria 3473
145 Ga0501047_0299186 3300049581 Bacteria 1452
146 Ga0501048_0048762 3300049582 Bacteria 3020
147 Ga0501070_0132017 3300049586 Bacteria 2063
148 Ga0501070_0139230 3300049586 Bacteria 2004
149 Ga0501080_0138157 3300049742 Bacteria 2254
150 Ga0501083_0008096 3300049744 Bacteria 7433
151 Ga0501083_0017143 3300049744 Bacteria 5052
152 Ga0501083_0091243 3300049744 Bacteria 2011
153 Ga0501035_0000168 3300049822 Bacteria 80065
154 Ga0501035_0004303 3300049822 Bacteria 13524
155 Ga0501035_0201013 3300049822 Bacteria 1709
156 Ga0501044_0000025 3300049823 Bacteria 187867
157 Ga0501044_0067546 3300049823 Bacteria 3642
158 Ga0501045_0072026 3300049824 Bacteria 2544
159 Ga0500622_0016424 3300053156 Bacteria 3956

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028666 Ga0265336_10020322 Ga0265336_100203222 303
2 3300028653 Ga0265323_10014487 Ga0265323_100144872 304
3 3300031235 Ga0265330_10031326 Ga0265330_100313263 304
4 3300049744 Ga0501083_0017143 Ga0501083_0017143_3305_4309 305
5 3300028653 Ga0265323_10002818 Ga0265323_100028185 306
6 3300031235 Ga0265330_10007900 Ga0265330_100079001 306
7 3300031344 Ga0265316_10027355 Ga0265316_100273552 306
8 3300031344 Ga0265316_10088737 Ga0265316_100887371 307
9 3300031711 Ga0265314_10015508 Ga0265314_100155082 307
10 3300035091 Ga0373951_0033545 Ga0373951_0033545_34_1044 311
11 3300031344 Ga0265316_10010449 Ga0265316_100104496 314
12 3300031344 Ga0265316_10072941 Ga0265316_100729412 318
13 3300049581 Ga0501047_0299186 Ga0501047_0299186_428_1438 322
14 3300031240 Ga0265320_10006661 Ga0265320_100066614 325
15 3300031240 Ga0265320_10055363 Ga0265320_100553632 325
16 3300053156 Ga0500622_0016424 Ga0500622_0016424_110_1120 326
17 3300046537 Ga0495598_0070128 Ga0495598_0070128_25_1032 330
18 3300005436 Ga0070713_100011079 Ga0070713_1000110793 334
19 3300005614 Ga0068856_100017437 Ga0068856_1000174373 334
20 3300014325 Ga0163163_10099884 Ga0163163_100998842 334
21 3300025928 Ga0207700_10003744 Ga0207700_100037445 334
22 3300025944 Ga0207661_10027368 Ga0207661_100273682 334
23 3300026041 Ga0207639_10204537 Ga0207639_102045372 334
24 3300029957 Ga0265324_10052890 Ga0265324_100528902 334
25 3300031595 Ga0265313_10008030 Ga0265313_100080308 334
26 3300045051 Ga0451576_0031566 Ga0451576_0031566_2030_3034 334
27 3300049568 Ga0501031_0037693 Ga0501031_0037693_912_1916 334
28 3300049569 Ga0501032_0027549 Ga0501032_0027549_1330_2334 334
29 3300049570 Ga0501033_0016866 Ga0501033_0016866_1075_2079 334
30 3300049571 Ga0501034_0101260 Ga0501034_0101260_1004_2008 334
31 3300049573 Ga0501037_0046399 Ga0501037_0046399_1815_2819 334
32 3300049574 Ga0501038_0020048 Ga0501038_0020048_1122_2126 334
33 3300049575 Ga0501039_0043359 Ga0501039_0043359_1791_2795 334
34 3300049822 Ga0501035_0004303 Ga0501035_0004303_5017_6021 334
35 3300049824 Ga0501045_0072026 Ga0501045_0072026_282_1286 334
36 3300003322 rootL2_10213016 rootL2_102130162 335
37 3300005327 Ga0070658_10049189 Ga0070658_100491893 335
38 3300025909 Ga0207705_10073222 Ga0207705_100732222 335
39 3300025944 Ga0207661_10030531 Ga0207661_100305312 335
40 3300028556 Ga0265337_1000519 Ga0265337_100051912 335
41 3300028556 Ga0265337_1031734 Ga0265337_10317341 335
42 3300028558 Ga0265326_10015740 Ga0265326_100157402 335
43 3300028558 Ga0265326_10030931 Ga0265326_100309312 335
44 3300028563 Ga0265319_1000050 Ga0265319_100005014 335
45 3300028563 Ga0265319_1000881 Ga0265319_100088110 335
46 3300028563 Ga0265319_1017148 Ga0265319_10171483 335
47 3300028563 Ga0265319_1046902 Ga0265319_10469021 335
48 3300028573 Ga0265334_10001557 Ga0265334_100015579 335
49 3300028573 Ga0265334_10004713 Ga0265334_100047133 335
50 3300028573 Ga0265334_10050844 Ga0265334_100508441 335
51 3300028577 Ga0265318_10000047 Ga0265318_1000004769 335
52 3300028577 Ga0265318_10000522 Ga0265318_1000052218 335
53 3300028577 Ga0265318_10001186 Ga0265318_1000118617 335
54 3300028577 Ga0265318_10002019 Ga0265318_1000201910 335
55 3300028577 Ga0265318_10006645 Ga0265318_100066454 335
56 3300028577 Ga0265318_10013368 Ga0265318_100133682 335
57 3300028666 Ga0265336_10000521 Ga0265336_1000052119 335
58 3300028800 Ga0265338_10000339 Ga0265338_1000033928 335
59 3300029957 Ga0265324_10004515 Ga0265324_1000451511 335
60 3300029957 Ga0265324_10015359 Ga0265324_100153592 335
61 3300031238 Ga0265332_10046982 Ga0265332_100469822 335
62 3300031240 Ga0265320_10001455 Ga0265320_1000145513 335
63 3300031240 Ga0265320_10002113 Ga0265320_100021132 335
64 3300031240 Ga0265320_10002186 Ga0265320_1000218613 335
65 3300031240 Ga0265320_10004051 Ga0265320_1000405110 335
66 3300031240 Ga0265320_10004225 Ga0265320_100042252 335
67 3300031240 Ga0265320_10007659 Ga0265320_100076595 335
68 3300031240 Ga0265320_10008226 Ga0265320_100082266 335
69 3300031240 Ga0265320_10016028 Ga0265320_100160285 335
70 3300031241 Ga0265325_10009672 Ga0265325_100096723 335
71 3300031249 Ga0265339_10072187 Ga0265339_100721872 335
72 3300031250 Ga0265331_10015765 Ga0265331_100157653 335
73 3300031250 Ga0265331_10029617 Ga0265331_100296172 335
74 3300031251 Ga0265327_10000325 Ga0265327_1000032527 335
75 3300031251 Ga0265327_10001875 Ga0265327_100018757 335
76 3300031251 Ga0265327_10002019 Ga0265327_1000201917 335
77 3300031251 Ga0265327_10009244 Ga0265327_100092443 335
78 3300031344 Ga0265316_10007866 Ga0265316_100078662 335
79 3300031344 Ga0265316_10013083 Ga0265316_100130832 335
80 3300031344 Ga0265316_10137625 Ga0265316_101376252 335
81 3300031595 Ga0265313_10000165 Ga0265313_1000016528 335
82 3300031595 Ga0265313_10001557 Ga0265313_1000155712 335
83 3300031595 Ga0265313_10002748 Ga0265313_1000274813 335
84 3300031595 Ga0265313_10056341 Ga0265313_100563412 335
85 3300031616 Ga0307508_10000006 Ga0307508_10000006116 335
86 3300031711 Ga0265314_10001982 Ga0265314_100019829 335
87 3300031711 Ga0265314_10005480 Ga0265314_100054804 335
88 3300031711 Ga0265314_10014596 Ga0265314_100145964 335
89 3300031712 Ga0265342_10055270 Ga0265342_100552701 335
90 3300031712 Ga0265342_10073076 Ga0265342_100730762 335
91 3300035121 Ga0373960_0049012 Ga0373960_0049012_148_1188 335
92 3300042004 Ga0439445_0030864 Ga0439445_0030864_241_1248 335
93 3300044712 Ga0453684_0027192 Ga0453684_0027192_2566_3573 335
94 3300044712 Ga0453684_0439276 Ga0453684_0439276_416_1423 335
95 3300045051 Ga0451576_0000071 Ga0451576_0000071_9187_10194 335
96 3300045051 Ga0451576_0002156 Ga0451576_0002156_3251_4258 335
97 3300045051 Ga0451576_0542482 Ga0451576_0542482_201_1211 335
98 3300049569 Ga0501032_0000292 Ga0501032_0000292_37303_38310 335
99 3300049571 Ga0501034_0041759 Ga0501034_0041759_1584_2594 335
100 3300049579 Ga0501043_0128055 Ga0501043_0128055_961_1968 335
101 3300049580 Ga0501046_0161082 Ga0501046_0161082_62_1069 335
102 3300049744 Ga0501083_0091243 Ga0501083_0091243_48_1058 335
103 3300049822 Ga0501035_0000168 Ga0501035_0000168_60709_61716 335
104 3300049823 Ga0501044_0000025 Ga0501044_0000025_163087_164094 335
105 3300003322 rootL2_10040216 rootL2_100402162 336
106 3300003323 rootH1_10311251 rootH1_103112514 336
107 3300028653 Ga0265323_10000076 Ga0265323_1000007618 336
108 3300028653 Ga0265323_10001322 Ga0265323_100013223 336
109 3300028653 Ga0265323_10006389 Ga0265323_100063895 336
110 3300028653 Ga0265323_10026367 Ga0265323_100263672 336
111 3300028654 Ga0265322_10000399 Ga0265322_100003999 336
112 3300028654 Ga0265322_10001481 Ga0265322_100014815 336
113 3300028800 Ga0265338_10009289 Ga0265338_100092895 336
114 3300031240 Ga0265320_10007843 Ga0265320_100078435 336
115 3300031250 Ga0265331_10067048 Ga0265331_100670482 336
116 3300031344 Ga0265316_10004508 Ga0265316_100045083 336
117 3300031595 Ga0265313_10001031 Ga0265313_1000103113 336
118 3300031595 Ga0265313_10017703 Ga0265313_100177033 336
119 3300031711 Ga0265314_10022053 Ga0265314_100220534 336
120 3300031712 Ga0265342_10003248 Ga0265342_100032488 336
121 3300031712 Ga0265342_10180710 Ga0265342_101807101 336
122 3300042876 Ga0451577_0000087 Ga0451577_0000087_80220_81233 336
123 3300042876 Ga0451577_0003447 Ga0451577_0003447_6750_7787 336
124 3300042876 Ga0451577_0028977 Ga0451577_0028977_501_1547 336
125 3300044673 Ga0453683_0000948 Ga0453683_0000948_7609_8676 336
126 3300044673 Ga0453683_0031400 Ga0453683_0031400_556_1626 336
127 3300044712 Ga0453684_0000001 Ga0453684_0000001_1687975_1688985 336
128 3300044712 Ga0453684_0122107 Ga0453684_0122107_515_1561 336
129 3300045051 Ga0451576_0001527 Ga0451576_0001527_28427_29494 336
130 3300045051 Ga0451576_0003954 Ga0451576_0003954_12238_13308 336
131 3300049586 Ga0501070_0139230 Ga0501070_0139230_249_1310 336
132 3300049744 Ga0501083_0008096 Ga0501083_0008096_853_1914 336
133 3300028563 Ga0265319_1049299 Ga0265319_10492992 337
134 3300031251 Ga0265327_10114079 Ga0265327_101140792 337
135 3300003320 rootH2_10030129 rootH2_100301292 338
136 3300005334 Ga0068869_100000032 Ga0068869_10000003229 338
137 3300006237 Ga0097621_100050598 Ga0097621_1000505983 338
138 3300006358 Ga0068871_100013226 Ga0068871_1000132265 338
139 3300006881 Ga0068865_100002429 Ga0068865_1000024293 338
140 3300025938 Ga0207704_10044273 Ga0207704_100442733 338
141 3300025942 Ga0207689_10000932 Ga0207689_1000093218 338
142 3300026089 Ga0207648_10001776 Ga0207648_100017762 338
143 3300031548 Ga0307408_100000003 Ga0307408_100000003146 338
144 3300031852 Ga0307410_10000002 Ga0307410_10000002111 338
145 3300031903 Ga0307407_10105879 Ga0307407_101058792 338
146 3300031911 Ga0307412_10020611 Ga0307412_100206113 338
147 3300031995 Ga0307409_100000025 Ga0307409_10000002528 338
148 3300032002 Ga0307416_100000012 Ga0307416_1000000125 338
149 3300037471 Ga0395905_0000010 Ga0395905_0000010_162990_164054 338
150 3300049569 Ga0501032_0041752 Ga0501032_0041752_674_1696 338
151 3300049570 Ga0501033_0000870 Ga0501033_0000870_2672_3694 338
152 3300049573 Ga0501037_0038145 Ga0501037_0038145_2488_3510 338
153 3300049580 Ga0501046_0001449 Ga0501046_0001449_5916_6938 338
154 3300049581 Ga0501047_0066542 Ga0501047_0066542_1987_3009 338
155 3300049582 Ga0501048_0048762 Ga0501048_0048762_1158_2180 338
156 3300049586 Ga0501070_0132017 Ga0501070_0132017_964_1986 338
157 3300049742 Ga0501080_0138157 Ga0501080_0138157_349_1371 338
158 3300049822 Ga0501035_0201013 Ga0501035_0201013_564_1586 338
159 3300049823 Ga0501044_0067546 Ga0501044_0067546_1504_2526 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01351

RNase_HII

Ribonuclease HII

124

328

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p83-assembly1.cif.gz_E structure of the pcna:rnase hii complex from archaeoglobus fulgidus. 0.8497 106 296
2dff-assembly1.cif.gz_A crystal structure of tk-rnase hii(1-204)-c 0.849 106 317
1io2-assembly1.cif.gz_A crystal structure of type 2 ribonuclease h from hyperthermophilic archaeon, thermococcus kodakaraensis kod1 0.8479 106 319
3p83-assembly1.cif.gz_F structure of the pcna:rnase hii complex from archaeoglobus fulgidus. 0.8478 107 314
1uax-assembly2.cif.gz_B crystal structure of the ribonuclease h2 from pyrococcus horikoshii ot3 0.8331 106 320
ID Description Score Start End Superfamily
3vn5A01 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein 0.9188 18 84 3.30.310.10
3asmA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9087 106 318 3.30.420.10
4py5A02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9034 106 308 3.30.420.10
af_Q2FZD7_96_311_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9034 106 317 3.30.420.10
4py5A02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8861 106 308 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A2L2X9D7-F1-model_v4 Ribonuclease (EC 3.1.26.4) 0.9681 106 314 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0032299
GO:0043137
GO:0046872
AF-A0A521L4I6-F1-model_v4 Ribonuclease (EC 3.1.26.4) 0.9658 105 316 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0032299
GO:0043137
GO:0046872
AF-A0A355RYF0-F1-model_v4 Ribonuclease (EC 3.1.26.4) 0.9637 105 313 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0032299
GO:0043137
GO:0046872
AF-A0A536RNY1-F1-model_v4 Ribonuclease (EC 3.1.26.4) 0.9627 105 317 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0032299
GO:0043137
GO:0046872
AF-A0A2M7WLR2-F1-model_v4 Ribonuclease (EC 3.1.26.4) 0.9611 105 318 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0032299
GO:0043137
GO:0046872

Feature Viewer

pLDDT pTM Quality
87.2 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map