F233173

General Info

Members Datasets Scaffolds Average Seq Length
159 80 318 296

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0001385|Ga0501046_0001385_17132_18121
Length 329
Sequence MDGYRRSGAKKRCGFSKSPCFLQQGFIALAVLLRMQSSPLTGTFTALVTPFRRQQVAYDDLAKLVAHQIRGGVDGLVPVGTTGESPTLSHEEHLDVIRAVIEAARGRVPVIAGTGSNSTQEAVELTTLSHEAGADAMLVVAPYYNKPSQEGLYRHFATLAEATDKPIILYSIPGRCGIEISVGVVERLRAKYAHVRTIKEAGGSVDRVDQLKQALGRDITVLSGDDSLTLPFMAVGAEGVISVASNLYVREVSQLVKLALGNDYRKAAALHRRLYPMFKAIFIEPNPVPIKAALVRAGIIGSSEVRAPLCEMSAANARVLTAALRPLDR

Samples

Sample ID Description Type Environment
1 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
17 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
18 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
19 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
20 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
26 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
27 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
28 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
29 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
30 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
31 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
32 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
33 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
34 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
35 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
36 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
37 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
38 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
39 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
40 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
41 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
42 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
43 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
44 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
45 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
46 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
50 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
51 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
52 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
53 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
54 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
55 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
56 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
57 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
58 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
71 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
72 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
73 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
74 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
75 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
77 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
78 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
79 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
80 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.26
Nodule 0
Rhizoplane 0
Rhizosphere 95.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501046_0001385 3300049580 Bacteria 23337
2 JGI24744J21845_10002481 3300002077 Bacteria 3760
3 rootH2_10168230 3300003320 Bacteria 3915
4 rootL2_10047548 3300003322 Bacteria 3897
5 rootH1_10044927 3300003323 Bacteria 4901
6 Ga0070683_100051732 3300005329 Bacteria 3804
7 Ga0068869_100000155 3300005334 Bacteria 34011
8 Ga0070666_10084538 3300005335 Bacteria 2172
9 Ga0068868_100009840 3300005338 Bacteria 6902
10 Ga0068868_100394532 3300005338 Bacteria 1193
11 Ga0070713_100005312 3300005436 Bacteria 8786
12 Ga0070663_100123508 3300005455 Bacteria 1958
13 Ga0068867_100001681 3300005459 Bacteria 15426
14 Ga0070684_100098314 3300005535 Bacteria 2611
15 Ga0070717_10000084 3300006028 Bacteria 74786
16 Ga0097621_100001190 3300006237 Bacteria 18019
17 Ga0068871_100004670 3300006358 Bacteria 9576
18 Ga0068865_100004355 3300006881 Bacteria 8542
19 Ga0157373_10031024 3300013100 Bacteria 3847
20 Ga0157370_10000979 3300013104 Bacteria 36192
21 Ga0207705_10183507 3300025909 Bacteria 1580
22 Ga0207704_10003138 3300025938 Bacteria 7475
23 Ga0207689_10000146 3300025942 Bacteria 60575
24 Ga0207661_10023360 3300025944 Bacteria 4671
25 Ga0207661_10048305 3300025944 Bacteria 3381
26 Ga0207648_10010766 3300026089 Bacteria 8641
27 Ga0265337_1001618 3300028556 Bacteria 10952
28 Ga0265337_1002625 3300028556 Bacteria 8106
29 Ga0265319_1000135 3300028563 Bacteria 54862
30 Ga0265319_1000374 3300028563 Bacteria 32370
31 Ga0265319_1001304 3300028563 Bacteria 15080
32 Ga0265319_1004992 3300028563 Bacteria 6459
33 Ga0265319_1021579 3300028563 Bacteria 2362
34 Ga0265319_1025076 3300028563 Bacteria 2138
35 Ga0265319_1057160 3300028563 Bacteria 1273
36 Ga0265334_10001803 3300028573 Bacteria 10200
37 Ga0265334_10022658 3300028573 Bacteria 2558
38 Ga0265334_10098516 3300028573 Bacteria 1060
39 Ga0265318_10000938 3300028577 Bacteria 18852
40 Ga0265318_10001600 3300028577 Bacteria 13103
41 Ga0265318_10002511 3300028577 Bacteria 9744
42 Ga0265318_10003848 3300028577 Bacteria 7420
43 Ga0265318_10014534 3300028577 Bacteria 3303
44 Ga0265318_10033292 3300028577 Bacteria 1990
45 Ga0265323_10000053 3300028653 Bacteria 62400
46 Ga0265323_10002410 3300028653 Bacteria 8593
47 Ga0265323_10005947 3300028653 Bacteria 5157
48 Ga0265323_10011138 3300028653 Bacteria 3633
49 Ga0265323_10011301 3300028653 Bacteria 3605
50 Ga0265323_10015788 3300028653 Bacteria 2964
51 Ga0265323_10019835 3300028653 Bacteria 2592
52 Ga0265323_10029626 3300028653 Bacteria 2046
53 Ga0265323_10046286 3300028653 Bacteria 1560
54 Ga0265323_10046735 3300028653 Bacteria 1551
55 Ga0265322_10000396 3300028654 Bacteria 18028
56 Ga0265336_10014578 3300028666 Bacteria 2601
57 Ga0265338_10000326 3300028800 Bacteria 86601
58 Ga0265338_10002999 3300028800 Bacteria 24420
59 Ga0265338_10036530 3300028800 Bacteria 4699
60 Ga0265338_10047351 3300028800 Bacteria 3928
61 Ga0265324_10009479 3300029957 Bacteria 3798
62 Ga0265324_10020578 3300029957 Bacteria 2369
63 Ga0265324_10042981 3300029957 Bacteria 1561
64 Ga0265324_10052513 3300029957 Bacteria 1400
65 Ga0265330_10013910 3300031235 Bacteria 3741
66 Ga0265330_10036052 3300031235 Bacteria 2206
67 Ga0265332_10107948 3300031238 Bacteria 1173
68 Ga0265320_10001414 3300031240 Bacteria 17441
69 Ga0265320_10002545 3300031240 Bacteria 12665
70 Ga0265320_10007277 3300031240 Bacteria 6888
71 Ga0265320_10015910 3300031240 Bacteria 4234
72 Ga0265320_10022839 3300031240 Bacteria 3340
73 Ga0265320_10030357 3300031240 Bacteria 2787
74 Ga0265320_10109025 3300031240 Bacteria 1270
75 Ga0265325_10005790 3300031241 Bacteria 7578
76 Ga0265325_10158279 3300031241 Bacteria 1067
77 Ga0265331_10012114 3300031250 Bacteria 4688
78 Ga0265327_10000016 3300031251 Bacteria 467439
79 Ga0265327_10005254 3300031251 Bacteria 10910
80 Ga0265327_10041672 3300031251 Bacteria 2472
81 Ga0265327_10061395 3300031251 Bacteria 1918
82 Ga0265316_10006094 3300031344 Bacteria 11570
83 Ga0265316_10008194 3300031344 Bacteria 9726
84 Ga0265316_10019805 3300031344 Bacteria 5746
85 Ga0265316_10166282 3300031344 Bacteria 1647
86 Ga0307408_100000017 3300031548 Bacteria 355890
87 Ga0265313_10000174 3300031595 Bacteria 68230
88 Ga0265313_10002097 3300031595 Bacteria 17783
89 Ga0265313_10002328 3300031595 Bacteria 16654
90 Ga0265313_10002340 3300031595 Bacteria 16573
91 Ga0265313_10003329 3300031595 Bacteria 13131
92 Ga0265313_10006976 3300031595 Bacteria 7834
93 Ga0265313_10078795 3300031595 Bacteria 1501
94 Ga0307508_10000160 3300031616 Bacteria 80743
95 Ga0265314_10002212 3300031711 Bacteria 20273
96 Ga0265314_10005388 3300031711 Bacteria 11564
97 Ga0265314_10009006 3300031711 Bacteria 8489
98 Ga0265342_10002683 3300031712 Bacteria 15141
99 Ga0265342_10026943 3300031712 Bacteria 3598
100 Ga0265342_10049985 3300031712 Bacteria 2500
101 Ga0307410_10000038 3300031852 Bacteria 48028
102 Ga0307409_100000871 3300031995 Bacteria 13966
103 Ga0307416_100000034 3300032002 Bacteria 155632
104 Ga0307411_10075364 3300032005 Bacteria 2303
105 Ga0373933_0124623 3300035724 Bacteria 1616
106 Ga0395905_0000010 3300037471 Bacteria 460729
107 Ga0395905_0171213 3300037471 Bacteria 2040
108 Ga0439443_020538 3300042003 Bacteria 1038
109 Ga0451577_0000012 3300042876 Bacteria 575467
110 Ga0453683_0000192 3300044673 Bacteria 84961
111 Ga0453683_0171007 3300044673 Bacteria 1376
112 Ga0453684_0039079 3300044712 Bacteria 6472
113 Ga0453684_0047279 3300044712 Bacteria 5709
114 Ga0453684_0498063 3300044712 Bacteria 1349
115 Ga0451576_0000162 3300045051 Bacteria 170196
116 Ga0451576_0003906 3300045051 Bacteria 19903
117 Ga0451576_0016493 3300045051 Bacteria 8150
118 Ga0451576_0027510 3300045051 Bacteria 6106
119 Ga0451576_0076001 3300045051 Bacteria 3495
120 Ga0495599_0209394 3300046678 Bacteria 1196
121 Ga0501031_0008866 3300049568 Bacteria 6537
122 Ga0501032_0001206 3300049569 Bacteria 20671
123 Ga0501033_0001062 3300049570 Bacteria 25078
124 Ga0501033_0002368 3300049570 Bacteria 16069
125 Ga0501034_0068307 3300049571 Bacteria 3564
126 Ga0501036_0006054 3300049572 Bacteria 9810
127 Ga0501037_0006771 3300049573 Bacteria 8375
128 Ga0501037_0014042 3300049573 Bacteria 5900
129 Ga0501038_0019463 3300049574 Bacteria 6117
130 Ga0501039_0013305 3300049575 Bacteria 6291
131 Ga0501042_0040370 3300049578 Bacteria 3318
132 Ga0501043_0071690 3300049579 Bacteria 2720
133 Ga0501043_0109607 3300049579 Bacteria 2168
134 Ga0501046_0029394 3300049580 Bacteria 4467
135 Ga0501046_0031057 3300049580 Bacteria 4333
136 Ga0501046_0092419 3300049580 Bacteria 2326
137 Ga0501047_0003787 3300049581 Bacteria 14239
138 Ga0501047_0016665 3300049581 Bacteria 7018
139 Ga0501047_0051784 3300049581 Bacteria 3967
140 Ga0501047_0082339 3300049581 Bacteria 3093
141 Ga0501048_0001712 3300049582 Bacteria 16726
142 Ga0501068_0133184 3300049584 Bacteria 1555
143 Ga0501073_0359397 3300049589 Bacteria 1006
144 Ga0501243_000057 3300049675 Bacteria 10912
145 Ga0501080_0090802 3300049742 Bacteria 2837
146 Ga0501080_0166158 3300049742 Bacteria 2036
147 Ga0501083_0006658 3300049744 Bacteria 8197
148 Ga0501083_0008478 3300049744 Bacteria 7262
149 Ga0501083_0158291 3300049744 Bacteria 1482
150 Ga0501035_0003241 3300049822 Bacteria 15596
151 Ga0501035_0017843 3300049822 Bacteria 6547
152 Ga0501035_0018694 3300049822 Bacteria 6382
153 Ga0501044_0001684 3300049823 Bacteria 25975
154 Ga0501044_0004444 3300049823 Bacteria 15686
155 Ga0501044_0033361 3300049823 Bacteria 5411
156 Ga0500559_0003249 3300053136 Bacteria 8077
157 Ga0500584_085095 3300053726 Bacteria 1343
158 Ga0501082_0082990 3300060353 Bacteria 2765
159 2788437551 2786546940 Bacteria 6396474
160 Ga0501046_0001385
161 JGI24744J21845_10002481
162 rootH2_10168230
163 rootL2_10047548
164 rootH1_10044927
165 Ga0070683_100051732
166 Ga0068869_100000155
167 Ga0070666_10084538
168 Ga0068868_100009840
169 Ga0068868_100394532
170 Ga0070713_100005312
171 Ga0070663_100123508
172 Ga0068867_100001681
173 Ga0070684_100098314
174 Ga0070717_10000084
175 Ga0097621_100001190
176 Ga0068871_100004670
177 Ga0068865_100004355
178 Ga0157373_10031024
179 Ga0157370_10000979
180 Ga0207705_10183507
181 Ga0207704_10003138
182 Ga0207689_10000146
183 Ga0207661_10023360
184 Ga0207661_10048305
185 Ga0207648_10010766
186 Ga0265337_1001618
187 Ga0265337_1002625
188 Ga0265319_1000135
189 Ga0265319_1000374
190 Ga0265319_1001304
191 Ga0265319_1004992
192 Ga0265319_1021579
193 Ga0265319_1025076
194 Ga0265319_1057160
195 Ga0265334_10001803
196 Ga0265334_10022658
197 Ga0265334_10098516
198 Ga0265318_10000938
199 Ga0265318_10001600
200 Ga0265318_10002511
201 Ga0265318_10003848
202 Ga0265318_10014534
203 Ga0265318_10033292
204 Ga0265323_10000053
205 Ga0265323_10002410
206 Ga0265323_10005947
207 Ga0265323_10011138
208 Ga0265323_10011301
209 Ga0265323_10015788
210 Ga0265323_10019835
211 Ga0265323_10029626
212 Ga0265323_10046286
213 Ga0265323_10046735
214 Ga0265322_10000396
215 Ga0265336_10014578
216 Ga0265338_10000326
217 Ga0265338_10002999
218 Ga0265338_10036530
219 Ga0265338_10047351
220 Ga0265324_10009479
221 Ga0265324_10020578
222 Ga0265324_10042981
223 Ga0265324_10052513
224 Ga0265330_10013910
225 Ga0265330_10036052
226 Ga0265332_10107948
227 Ga0265320_10001414
228 Ga0265320_10002545
229 Ga0265320_10007277
230 Ga0265320_10015910
231 Ga0265320_10022839
232 Ga0265320_10030357
233 Ga0265320_10109025
234 Ga0265325_10005790
235 Ga0265325_10158279
236 Ga0265331_10012114
237 Ga0265327_10000016
238 Ga0265327_10005254
239 Ga0265327_10041672
240 Ga0265327_10061395
241 Ga0265316_10006094
242 Ga0265316_10008194
243 Ga0265316_10019805
244 Ga0265316_10166282
245 Ga0307408_100000017
246 Ga0265313_10000174
247 Ga0265313_10002097
248 Ga0265313_10002328
249 Ga0265313_10002340
250 Ga0265313_10003329
251 Ga0265313_10006976
252 Ga0265313_10078795
253 Ga0307508_10000160
254 Ga0265314_10002212
255 Ga0265314_10005388
256 Ga0265314_10009006
257 Ga0265342_10002683
258 Ga0265342_10026943
259 Ga0265342_10049985
260 Ga0307410_10000038
261 Ga0307409_100000871
262 Ga0307416_100000034
263 Ga0307411_10075364
264 Ga0373933_0124623
265 Ga0395905_0000010
266 Ga0395905_0171213
267 Ga0439443_020538
268 Ga0451577_0000012
269 Ga0453683_0000192
270 Ga0453683_0171007
271 Ga0453684_0039079
272 Ga0453684_0047279
273 Ga0453684_0498063
274 Ga0451576_0000162
275 Ga0451576_0003906
276 Ga0451576_0016493
277 Ga0451576_0027510
278 Ga0451576_0076001
279 Ga0495599_0209394
280 Ga0501031_0008866
281 Ga0501032_0001206
282 Ga0501033_0001062
283 Ga0501033_0002368
284 Ga0501034_0068307
285 Ga0501036_0006054
286 Ga0501037_0006771
287 Ga0501037_0014042
288 Ga0501038_0019463
289 Ga0501039_0013305
290 Ga0501042_0040370
291 Ga0501043_0071690
292 Ga0501043_0109607
293 Ga0501046_0029394
294 Ga0501046_0031057
295 Ga0501046_0092419
296 Ga0501047_0003787
297 Ga0501047_0016665
298 Ga0501047_0051784
299 Ga0501047_0082339
300 Ga0501048_0001712
301 Ga0501068_0133184
302 Ga0501073_0359397
303 Ga0501243_000057
304 Ga0501080_0090802
305 Ga0501080_0166158
306 Ga0501083_0006658
307 Ga0501083_0008478
308 Ga0501083_0158291
309 Ga0501035_0003241
310 Ga0501035_0017843
311 Ga0501035_0018694
312 Ga0501044_0001684
313 Ga0501044_0004444
314 Ga0501044_0033361
315 Ga0500559_0003249
316 Ga0500584_085095
317 Ga0501082_0082990
318 2788437551

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

39

326

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6t3t-assembly1.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9882 2 288
2yxg-assembly1.cif.gz_D crystal structure of dihyrodipicolinate synthase (dapa) 0.9826 3 293
2ehh-assembly1.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9821 3 292
2yxg-assembly1.cif.gz_D crystal structure of dihyrodipicolinate synthase (dapa) 0.9792 3 293
3ird-assembly1.cif.gz_A structure of dihydrodipicolinate synthase from clostridium botulinum 0.9758 3 293
ID Description Score Start End Superfamily
2yxgD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9826 3 293 3.20.20.70
2yxgD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9792 3 293 3.20.20.70
3a5fA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9746 3 293 3.20.20.70
5f1uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9718 3 290 3.20.20.70
2rfgB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9656 3 291 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A840V4U2-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9918 1 293 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A2T6CT88-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9841 1 293 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-D3S6L2-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9829 3 293 GO:0005737
GO:0008675
GO:0008840
GO:0009089
GO:0019877
AF-A0A7C2KGJ5-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) 0.9823 3 234 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A2T6CT88-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9808 1 293 GO:0005829
GO:0008840
GO:0009089
GO:0019877

Map