F232483

General Info

Members Datasets Scaffolds Average Seq Length
159 120 159 143

Family's Representative Sequence

Representative Sequence 3300031240|Ga0265320_10378073|Ga0265320_103780732
Length 149
Sequence MKFPRNARIFRGQLDATPYASVFFLLVIFVLLSALIYTPGIHIELPEVSASLVTGVDGPTVAVAMDKNGQLYYDNELLAADALKKRLRAAAQKAAQPLTLVVRGDKAATYEMCVQLAAMVQDPELKIKTVIWQTLPPMMDAPPAKSAQP

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
63 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
66 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
67 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
68 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
69 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
70 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
71 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
72 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
73 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
74 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
75 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
76 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
84 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
85 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
86 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
95 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
101 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
102 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
103 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
110 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
118 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
119 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
120 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 1.26
Rhizosphere 97.48
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_101773846 3300005329 Unclassified 593
2 Ga0070690_100423860 3300005330 Bacteria 982
3 Ga0068868_101986482 3300005338 Unclassified 552
4 Ga0070689_100018150 3300005340 Bacteria 5178
5 Ga0070689_100274008 3300005340 Bacteria 1398
6 Ga0070689_100322856 3300005340 Bacteria 1290
7 Ga0070689_100489198 3300005340 Unclassified 1052
8 Ga0070689_100531938 3300005340 Bacteria 1011
9 Ga0070691_10047513 3300005341 Bacteria 2041
10 Ga0070675_101172116 3300005354 Unclassified 707
11 Ga0070714_100009383 3300005435 Bacteria 7689
12 Ga0070713_100293895 3300005436 Unclassified 1494
13 Ga0070713_100685006 3300005436 Unclassified 978
14 Ga0070701_10692136 3300005438 Unclassified 685
15 Ga0070705_101176044 3300005440 Unclassified 631
16 Ga0070681_10085347 3300005458 Unclassified 3110
17 Ga0068867_100270889 3300005459 Unclassified 1388
18 Ga0070685_10519074 3300005466 Bacteria 846
19 Ga0070707_100630308 3300005468 Bacteria 1035
20 Ga0070697_100335063 3300005536 Unclassified 1305
21 Ga0070704_100420792 3300005549 Bacteria 1144
22 Ga0068855_100257480 3300005563 Unclassified 1945
23 Ga0068855_100547262 3300005563 Unclassified 1253
24 Ga0068856_100100583 3300005614 Unclassified 2883
25 Ga0070702_100627745 3300005615 Unclassified 809
26 Ga0068852_100760371 3300005616 Unclassified 981
27 Ga0068859_100148667 3300005617 Bacteria 2418
28 Ga0068859_100396388 3300005617 Bacteria 1476
29 Ga0068859_100903248 3300005617 Unclassified 968
30 Ga0068859_101791826 3300005617 Unclassified 678
31 Ga0068863_100198754 3300005841 Bacteria 1928
32 Ga0068863_101018083 3300005841 Bacteria 831
33 Ga0068858_101407046 3300005842 Bacteria 687
34 Ga0097621_100087789 3300006237 Bacteria 2598
35 Ga0075431_100987280 3300006847 Unclassified 809
36 Ga0075434_100082463 3300006871 Bacteria 3213
37 Ga0075436_100507651 3300006914 Bacteria 882
38 Ga0075436_101514631 3300006914 Bacteria 509
39 Ga0097620_100148666 3300006931 Bacteria 2418
40 Ga0097620_100396391 3300006931 Bacteria 1476
41 Ga0097620_100903222 3300006931 Unclassified 968
42 Ga0097620_101792487 3300006931 Unclassified 678
43 Ga0075435_100391681 3300007076 Unclassified 1194
44 Ga0099794_10193338 3300007265 Bacteria 1041
45 Ga0105240_10109157 3300009093 Unclassified 3351
46 Ga0111539_10056176 3300009094 Bacteria 4680
47 Ga0111539_10095819 3300009094 Bacteria 3486
48 Ga0105245_10222101 3300009098 Unclassified 1823
49 Ga0105242_10947270 3300009176 Unclassified 865
50 Ga0105238_10059968 3300009551 Unclassified 3810
51 Ga0105249_11355797 3300009553 Unclassified 783
52 Ga0105249_12043254 3300009553 Bacteria 646
53 Ga0157370_10161280 3300013104 Bacteria 2086
54 Ga0157374_10754326 3300013296 Unclassified 988
55 Ga0157378_11212637 3300013297 Unclassified 794
56 Ga0157372_10602080 3300013307 Unclassified 1281
57 Ga0157375_12132604 3300013308 Unclassified 667
58 Ga0163163_10569914 3300014325 Bacteria 1195
59 Ga0207695_10403805 3300025913 Bacteria 1251
60 Ga0207663_11700215 3300025916 Unclassified 508
61 Ga0207660_11337042 3300025917 Unclassified 581
62 Ga0207652_10389106 3300025921 Unclassified 1258
63 Ga0207652_10710928 3300025921 Unclassified 896
64 Ga0207646_10819924 3300025922 Unclassified 828
65 Ga0207694_10062678 3300025924 Unclassified 2895
66 Ga0207687_10113769 3300025927 Bacteria 2013
67 Ga0207664_10037696 3300025929 Bacteria 3744
68 Ga0207670_10010654 3300025936 Bacteria 5304
69 Ga0207670_10278567 3300025936 Bacteria 1303
70 Ga0207670_10409101 3300025936 Bacteria 1086
71 Ga0207670_10614066 3300025936 Unclassified 894
72 Ga0207667_10276261 3300025949 Unclassified 1717
73 Ga0207639_10279342 3300026041 Unclassified 1468
74 Ga0207708_10259062 3300026075 Bacteria 1403
75 Ga0207702_10881199 3300026078 Bacteria 886
76 Ga0207641_10962446 3300026088 Bacteria 849
77 Ga0207428_10146756 3300027907 Unclassified 1797
78 Ga0265337_1026899 3300028556 Unclassified 1738
79 Ga0265334_10065196 3300028573 Bacteria 1366
80 Ga0265318_10152623 3300028577 Bacteria 847
81 Ga0265338_10003874 3300028800 Bacteria 20711
82 Ga0265338_10026071 3300028800 Bacteria 5909
83 Ga0265338_10172839 3300028800 Bacteria 1655
84 Ga0265320_10038946 3300031240 Unclassified 2380
85 Ga0265320_10378073 3300031240 Bacteria 626
86 Ga0265325_10203489 3300031241 Unclassified 912
87 Ga0265316_10290705 3300031344 Bacteria 1192
88 Ga0307508_10649930 3300031616 Unclassified 660
89 Ga0316575_10126799 3300031665 Bacteria 1046
90 Ga0316576_10204504 3300031727 Unclassified 1487
91 Ga0316578_10201517 3300031728 Unclassified 1198
92 Ga0316585_10180807 3300032137 Bacteria 697
93 Ga0316580_10079973 3300032139 Bacteria 1000
94 Ga0373951_0137723 3300035091 Unclassified 676
95 Ga0373923_0147573 3300035111 Bacteria 1066
96 Ga0373954_0019784 3300035118 Unclassified 3039
97 Ga0373956_0063275 3300035119 Unclassified 1678
98 Ga0316574_0328956 3300035398 Bacteria 969
99 Ga0373924_0057014 3300035410 Unclassified 1628
100 Ga0373931_0101870 3300035691 Unclassified 1616
101 Ga0373937_0570070 3300036401 Unclassified 1075
102 Ga0373937_1912303 3300036401 Bacteria 539
103 Ga0316582_0398693 3300036647 Bacteria 948
104 Ga0451577_0000685 3300042876 Bacteria 53326
105 Ga0451577_0039195 3300042876 Bacteria 4258
106 Ga0451577_0809574 3300042876 Unclassified 846
107 Ga0453684_0008613 3300044712 Bacteria 18183
108 Ga0451576_0078124 3300045051 Bacteria 3445
109 Ga0451576_0082231 3300045051 Bacteria 3349
110 Ga0451576_0083366 3300045051 Bacteria 3326
111 Ga0451576_0224184 3300045051 Bacteria 1963
112 Ga0451576_0451129 3300045051 Unclassified 1350
113 Ga0451576_0950151 3300045051 Bacteria 901
114 Ga0495590_0184145 3300046457 Bacteria 764
115 Ga0495651_0103038 3300046462 Unclassified 2121
116 Ga0495639_0167992 3300046475 Unclassified 1064
117 Ga0495662_0136965 3300046476 Bacteria 1204
118 Ga0495664_0189200 3300046477 Bacteria 1248
119 Ga0495594_0638164 3300046499 Unclassified 603
120 Ga0495608_0854022 3300046511 Unclassified 535
121 Ga0495628_0044301 3300046516 Bacteria 3541
122 Ga0495630_0127665 3300046517 Unclassified 1930
123 Ga0495630_0453982 3300046517 Bacteria 982
124 Ga0495666_0459926 3300046526 Bacteria 570
125 Ga0495652_0154853 3300046529 Unclassified 1786
126 Ga0495665_0057745 3300046531 Unclassified 2049
127 Ga0495586_0089515 3300046535 Unclassified 1699
128 Ga0495645_0038265 3300046543 Bacteria 3499
129 Ga0495667_0338972 3300046559 Unclassified 951
130 Ga0495634_0070354 3300046642 Unclassified 2307
131 Ga0495635_0283809 3300046663 Bacteria 1112
132 Ga0495588_0340511 3300046674 Unclassified 789
133 Ga0495657_0056909 3300046675 Bacteria 2602
134 Ga0495599_0116613 3300046678 Unclassified 1661
135 Ga0495599_0213296 3300046678 Bacteria 1183
136 Ga0495658_0888442 3300046683 Unclassified 570
137 Ga0495600_0328513 3300046809 Unclassified 961
138 Ga0495600_0449850 3300046809 Bacteria 797
139 Ga0495604_0166355 3300047317 Unclassified 1555
140 Ga0495674_0252338 3300047319 Unclassified 1452
141 Ga0495680_0388230 3300047322 Unclassified 966
142 Ga0495680_0839775 3300047322 Bacteria 597
143 Ga0495675_0186075 3300047444 Bacteria 1270
144 Ga0495675_0209345 3300047444 Bacteria 1184
145 Ga0495677_0054424 3300047445 Bacteria 1476
146 Ga0495593_0254778 3300047673 Bacteria 879
147 Ga0496115_0039351 3300048918 Unclassified 3755
148 Ga0496115_0264509 3300048918 Bacteria 1414
149 Ga0501033_0062755 3300049570 Bacteria 2736
150 Ga0501034_0695857 3300049571 Unclassified 915
151 nmdc:mga06r32_175619_c1 3300050510 Bacteria 2126
152 nmdc:mga08y16_162171_c1 3300050511 Bacteria 2323
153 nmdc:mga08y16_50316_c1 3300050511 Bacteria 4361
154 nmdc:mga0n895_309524_c1 3300050512 Unclassified 1601
155 nmdc:mga0rr50_448048_c1 3300050513 Unclassified 1094
156 Ga0495595_0659518 3300053084 Bacteria 536
157 Ga0500650_0138999 3300053098 Bacteria 1127
158 Ga0466962_0369933 3300061719 Unclassified 715
159 Ga0466962_0643141 3300061719 Unclassified 542

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_101172116 Ga0070675_1011721161 129
2 3300005617 Ga0068859_100903248 Ga0068859_1009032481 129
3 3300006931 Ga0097620_100903222 Ga0097620_1009032222 129
4 3300009553 Ga0105249_11355797 Ga0105249_113557972 129
5 3300046499 Ga0495594_0638164 Ga0495594_0638164_105_506 129
6 3300042876 Ga0451577_0000685 Ga0451577_0000685_46983_47408 130
7 3300044712 Ga0453684_0008613 Ga0453684_0008613_11824_12249 130
8 3300005617 Ga0068859_100148667 Ga0068859_1001486674 133
9 3300006914 Ga0075436_101514631 Ga0075436_1015146311 133
10 3300006931 Ga0097620_100148666 Ga0097620_1001486664 133
11 3300025922 Ga0207646_10819924 Ga0207646_108199242 135
12 3300050511 nmdc:mga08y16_162171_c1 nmdc:mga08y16_162171_c1_785_1225 136
13 3300045051 Ga0451576_0224184 Ga0451576_0224184_695_1108 137
14 3300046683 Ga0495658_0888442 Ga0495658_0888442_147_560 137
15 3300047322 Ga0495680_0388230 Ga0495680_0388230_533_946 137
16 3300042876 Ga0451577_0809574 Ga0451577_0809574_129_545 138
17 3300045051 Ga0451576_0083366 Ga0451576_0083366_484_903 139
18 3300046511 Ga0495608_0854022 Ga0495608_0854022_39_464 139
19 3300046517 Ga0495630_0453982 Ga0495630_0453982_224_649 139
20 3300046526 Ga0495666_0459926 Ga0495666_0459926_118_537 139
21 3300046663 Ga0495635_0283809 Ga0495635_0283809_599_1024 139
22 3300005459 Ga0068867_100270889 Ga0068867_1002708892 140
23 3300005615 Ga0070702_100627745 Ga0070702_1006277452 140
24 3300005842 Ga0068858_101407046 Ga0068858_1014070462 140
25 3300006237 Ga0097621_100087789 Ga0097621_1000877892 140
26 3300007076 Ga0075435_100391681 Ga0075435_1003916812 140
27 3300009098 Ga0105245_10222101 Ga0105245_102221012 140
28 3300009176 Ga0105242_10947270 Ga0105242_109472702 140
29 3300013104 Ga0157370_10161280 Ga0157370_101612805 140
30 3300025927 Ga0207687_10113769 Ga0207687_101137693 140
31 3300046457 Ga0495590_0184145 Ga0495590_0184145_150_572 140
32 3300046516 Ga0495628_0044301 Ga0495628_0044301_812_1240 140
33 3300046674 Ga0495588_0340511 Ga0495588_0340511_277_705 140
34 3300046678 Ga0495599_0213296 Ga0495599_0213296_230_658 140
35 3300047445 Ga0495677_0054424 Ga0495677_0054424_935_1363 140
36 3300050513 nmdc:mga0rr50_448048_c1 nmdc:mga0rr50_448048_c1_280_708 140
37 3300053098 Ga0500650_0138999 Ga0500650_0138999_497_934 140
38 3300005338 Ga0068868_101986482 Ga0068868_1019864821 141
39 3300005340 Ga0070689_100489198 Ga0070689_1004891982 141
40 3300005341 Ga0070691_10047513 Ga0070691_100475132 141
41 3300005435 Ga0070714_100009383 Ga0070714_1000093834 141
42 3300005436 Ga0070713_100293895 Ga0070713_1002938952 141
43 3300005436 Ga0070713_100685006 Ga0070713_1006850062 141
44 3300005458 Ga0070681_10085347 Ga0070681_100853475 141
45 3300005563 Ga0068855_100257480 Ga0068855_1002574803 141
46 3300005563 Ga0068855_100547262 Ga0068855_1005472622 141
47 3300005614 Ga0068856_100100583 Ga0068856_1001005835 141
48 3300005617 Ga0068859_100396388 Ga0068859_1003963882 141
49 3300005617 Ga0068859_101791826 Ga0068859_1017918262 141
50 3300005841 Ga0068863_100198754 Ga0068863_1001987542 141
51 3300006931 Ga0097620_100396391 Ga0097620_1003963912 141
52 3300006931 Ga0097620_101792487 Ga0097620_1017924872 141
53 3300007265 Ga0099794_10193338 Ga0099794_101933382 141
54 3300009093 Ga0105240_10109157 Ga0105240_101091572 141
55 3300009551 Ga0105238_10059968 Ga0105238_100599684 141
56 3300009553 Ga0105249_12043254 Ga0105249_120432542 141
57 3300013296 Ga0157374_10754326 Ga0157374_107543261 141
58 3300013307 Ga0157372_10602080 Ga0157372_106020802 141
59 3300013308 Ga0157375_12132604 Ga0157375_121326041 141
60 3300014325 Ga0163163_10569914 Ga0163163_105699141 141
61 3300025913 Ga0207695_10403805 Ga0207695_104038052 141
62 3300025917 Ga0207660_11337042 Ga0207660_113370421 141
63 3300025921 Ga0207652_10389106 Ga0207652_103891061 141
64 3300025921 Ga0207652_10710928 Ga0207652_107109282 141
65 3300025924 Ga0207694_10062678 Ga0207694_100626783 141
66 3300025929 Ga0207664_10037696 Ga0207664_100376964 141
67 3300025936 Ga0207670_10614066 Ga0207670_106140662 141
68 3300025949 Ga0207667_10276261 Ga0207667_102762613 141
69 3300026041 Ga0207639_10279342 Ga0207639_102793422 141
70 3300026078 Ga0207702_10881199 Ga0207702_108811992 141
71 3300028556 Ga0265337_1026899 Ga0265337_10268993 141
72 3300028573 Ga0265334_10065196 Ga0265334_100651962 141
73 3300028577 Ga0265318_10152623 Ga0265318_101526232 141
74 3300028800 Ga0265338_10003874 Ga0265338_100038747 141
75 3300028800 Ga0265338_10026071 Ga0265338_100260718 141
76 3300028800 Ga0265338_10172839 Ga0265338_101728392 141
77 3300031240 Ga0265320_10038946 Ga0265320_100389464 141
78 3300031344 Ga0265316_10290705 Ga0265316_102907052 141
79 3300031616 Ga0307508_10649930 Ga0307508_106499302 141
80 3300035091 Ga0373951_0137723 Ga0373951_0137723_207_641 141
81 3300035410 Ga0373924_0057014 Ga0373924_0057014_579_1010 141
82 3300035691 Ga0373931_0101870 Ga0373931_0101870_21_455 141
83 3300042876 Ga0451577_0039195 Ga0451577_0039195_1923_2354 141
84 3300046462 Ga0495651_0103038 Ga0495651_0103038_1593_2024 141
85 3300046475 Ga0495639_0167992 Ga0495639_0167992_226_657 141
86 3300046476 Ga0495662_0136965 Ga0495662_0136965_560_991 141
87 3300046477 Ga0495664_0189200 Ga0495664_0189200_75_506 141
88 3300046517 Ga0495630_0127665 Ga0495630_0127665_721_1152 141
89 3300046529 Ga0495652_0154853 Ga0495652_0154853_670_1101 141
90 3300046531 Ga0495665_0057745 Ga0495665_0057745_662_1093 141
91 3300046535 Ga0495586_0089515 Ga0495586_0089515_789_1220 141
92 3300046543 Ga0495645_0038265 Ga0495645_0038265_2370_2801 141
93 3300046559 Ga0495667_0338972 Ga0495667_0338972_487_918 141
94 3300046642 Ga0495634_0070354 Ga0495634_0070354_480_911 141
95 3300046678 Ga0495599_0116613 Ga0495599_0116613_522_953 141
96 3300047319 Ga0495674_0252338 Ga0495674_0252338_268_699 141
97 3300047444 Ga0495675_0209345 Ga0495675_0209345_670_1101 141
98 3300048918 Ga0496115_0039351 Ga0496115_0039351_1793_2242 141
99 3300048918 Ga0496115_0264509 Ga0496115_0264509_707_1147 141
100 3300049570 Ga0501033_0062755 Ga0501033_0062755_1892_2332 141
101 3300049571 Ga0501034_0695857 Ga0501034_0695857_386_826 141
102 3300061719 Ga0466962_0369933 Ga0466962_0369933_122_562 141
103 3300005330 Ga0070690_100423860 Ga0070690_1004238602 142
104 3300005340 Ga0070689_100018150 Ga0070689_1000181505 142
105 3300005340 Ga0070689_100274008 Ga0070689_1002740082 142
106 3300005340 Ga0070689_100322856 Ga0070689_1003228562 142
107 3300005340 Ga0070689_100531938 Ga0070689_1005319382 142
108 3300005438 Ga0070701_10692136 Ga0070701_106921362 142
109 3300005440 Ga0070705_101176044 Ga0070705_1011760441 142
110 3300005466 Ga0070685_10519074 Ga0070685_105190742 142
111 3300005468 Ga0070707_100630308 Ga0070707_1006303081 142
112 3300005536 Ga0070697_100335063 Ga0070697_1003350632 142
113 3300005549 Ga0070704_100420792 Ga0070704_1004207922 142
114 3300005841 Ga0068863_101018083 Ga0068863_1010180832 142
115 3300006847 Ga0075431_100987280 Ga0075431_1009872802 142
116 3300006871 Ga0075434_100082463 Ga0075434_1000824634 142
117 3300006914 Ga0075436_100507651 Ga0075436_1005076512 142
118 3300009094 Ga0111539_10056176 Ga0111539_100561764 142
119 3300009094 Ga0111539_10095819 Ga0111539_100958192 142
120 3300013297 Ga0157378_11212637 Ga0157378_112126372 142
121 3300025916 Ga0207663_11700215 Ga0207663_117002151 142
122 3300025936 Ga0207670_10010654 Ga0207670_100106545 142
123 3300025936 Ga0207670_10278567 Ga0207670_102785672 142
124 3300025936 Ga0207670_10409101 Ga0207670_104091012 142
125 3300026075 Ga0207708_10259062 Ga0207708_102590622 142
126 3300026088 Ga0207641_10962446 Ga0207641_109624461 142
127 3300027907 Ga0207428_10146756 Ga0207428_101467562 142
128 3300031665 Ga0316575_10126799 Ga0316575_101267992 142
129 3300031727 Ga0316576_10204504 Ga0316576_102045043 142
130 3300031728 Ga0316578_10201517 Ga0316578_102015172 142
131 3300032137 Ga0316585_10180807 Ga0316585_101808072 142
132 3300032139 Ga0316580_10079973 Ga0316580_100799732 142
133 3300035111 Ga0373923_0147573 Ga0373923_0147573_115_555 142
134 3300035118 Ga0373954_0019784 Ga0373954_0019784_391_831 142
135 3300035119 Ga0373956_0063275 Ga0373956_0063275_737_1177 142
136 3300035398 Ga0316574_0328956 Ga0316574_0328956_138_578 142
137 3300036401 Ga0373937_0570070 Ga0373937_0570070_611_1051 142
138 3300036401 Ga0373937_1912303 Ga0373937_1912303_16_453 142
139 3300036647 Ga0316582_0398693 Ga0316582_0398693_39_479 142
140 3300045051 Ga0451576_0078124 Ga0451576_0078124_1618_2055 142
141 3300045051 Ga0451576_0082231 Ga0451576_0082231_1077_1511 142
142 3300045051 Ga0451576_0451129 Ga0451576_0451129_511_951 142
143 3300045051 Ga0451576_0950151 Ga0451576_0950151_54_488 142
144 3300046675 Ga0495657_0056909 Ga0495657_0056909_1773_2207 142
145 3300046809 Ga0495600_0328513 Ga0495600_0328513_390_830 142
146 3300046809 Ga0495600_0449850 Ga0495600_0449850_259_696 142
147 3300047317 Ga0495604_0166355 Ga0495604_0166355_353_790 142
148 3300047322 Ga0495680_0839775 Ga0495680_0839775_103_540 142
149 3300047444 Ga0495675_0186075 Ga0495675_0186075_294_731 142
150 3300047673 Ga0495593_0254778 Ga0495593_0254778_120_557 142
151 3300050510 nmdc:mga06r32_175619_c1 nmdc:mga06r32_175619_c1_1546_1980 142
152 3300050511 nmdc:mga08y16_50316_c1 nmdc:mga08y16_50316_c1_940_1374 142
153 3300050512 nmdc:mga0n895_309524_c1 nmdc:mga0n895_309524_c1_428_865 142
154 3300053084 Ga0495595_0659518 Ga0495595_0659518_20_457 142
155 3300061719 Ga0466962_0643141 Ga0466962_0643141_88_519 142
156 3300005329 Ga0070683_101773846 Ga0070683_1017738461 143
157 3300005616 Ga0068852_100760371 Ga0068852_1007603712 143
158 3300031240 Ga0265320_10378073 Ga0265320_103780732 143
159 3300031241 Ga0265325_10203489 Ga0265325_102034892 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

10

130

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8414 59 130
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8115 59 130
6utq-assembly1.cif.gz_A lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase in complex with cadmium 0.789 83 132
5unm-assembly1.cif.gz_F lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, substrate free form with flexible loop 0.7832 81 132
6b2o-assembly1.cif.gz_F lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, c176a variant 0.7787 86 132
ID Description Score Start End Superfamily
af_Q4CPS5_96_347_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7639 79 129 3.20.20.70
1u04A03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7454 79 131 3.40.50.2300
af_Q2FZX4_3_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7399 83 137 3.20.20.70
af_A0A1D8PCJ9_329_593_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.732 79 131 3.30.420.40
af_P60716_82_298_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7299 77 137 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2G5KPD3-F1-model_v4 Uncharacterized protein 0.9143 59 122
AF-A0A6N6MAC4-F1-model_v4 Uncharacterized protein 0.8965 59 122 GO:0005886
GO:0015031
GO:0022857
AF-A0A7X8Q9I2-F1-model_v4 Uncharacterized protein 0.8798 58 123
AF-A0A399SRP9-F1-model_v4 DUF4476 domain-containing protein 0.8791 56 122
AF-A0A7L4ZJM1-F1-model_v4 Chaperone SurA 0.8777 59 122

Feature Viewer

pLDDT pTM Quality
74.87 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map