F232480

General Info

Members Datasets Scaffolds Average Seq Length
159 76 318 300

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10091548|Ga0265330_100915481
Length 326
Sequence MPVWLRQNSAEEIFPSAASVYSVGSVGTSYKIGVDGGGTKTECILVAGSGEIVARHLAPGCNPSVIGPEQARLVVTDALCQLIAPFDPRAASPGGRIDTILLCMAGSRSFWQEFGASLTDFGRVTVTDDALPVLELATDGGPGLVLHGGTGSFIAARAPDGTVHYAGGLGWRFGDPGSGYEIGRRAIARALLELQGWAPPSRLSATVRDQTHLADAGAITRHFYHDAEPNRQIAALAPAVLRLAEEGDHTAHQLILDACAPLLELALQVAARLFPETPFDTVRAGLSGPILTHPTVVAALAPRSPLPLRPIAAPPIEGVWRLLVRS

Samples

Sample ID Description Type Environment
1 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
15 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
16 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
17 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
24 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
25 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
26 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
27 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
28 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
29 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
30 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
31 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
32 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
33 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
34 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
35 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
36 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
37 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
38 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
39 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
40 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
41 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
42 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
43 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
49 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
50 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
51 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
52 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
53 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
54 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
55 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
56 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
59 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
60 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
71 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
72 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
73 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
75 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
76 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.26
Nodule 0
Rhizoplane 0
Rhizosphere 94.97
Stem 0
Stem Tuber 0
Unclassified 8.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265330_10091548 3300031235 Unclassified 1305
2 rootH2_10030696 3300003320 Bacteria 3649
3 rootL2_10073071 3300003322 Bacteria 5865
4 rootL2_10372107 3300003322 Unclassified 1274
5 rootH1_10011846 3300003323 Bacteria 6115
6 rootH1_10168664 3300003323 Bacteria 3098
7 Ga0070683_100085165 3300005329 Bacteria 2962
8 Ga0070670_100283144 3300005331 Unclassified 1448
9 Ga0068869_100004131 3300005334 Bacteria 9004
10 Ga0068868_100050456 3300005338 Bacteria 3268
11 Ga0068867_100005667 3300005459 Bacteria 8847
12 Ga0070679_100030845 3300005530 Bacteria 5297
13 Ga0068855_100247534 3300005563 Unclassified 1989
14 Ga0068856_100019616 3300005614 Bacteria 6563
15 Ga0097621_100001673 3300006237 Bacteria 15167
16 Ga0068871_100002771 3300006358 Bacteria 11968
17 Ga0068865_100163974 3300006881 Bacteria 1698
18 Ga0163163_10373723 3300014325 Bacteria 1483
19 Ga0207705_10115230 3300025909 Bacteria 1989
20 Ga0207652_10074913 3300025921 Unclassified 2948
21 Ga0207689_10008807 3300025942 Bacteria 8771
22 Ga0207661_10006575 3300025944 Bacteria 8220
23 Ga0207677_10061209 3300026023 Bacteria 2606
24 Ga0207648_10003192 3300026089 Bacteria 17267
25 Ga0265337_1000076 3300028556 Bacteria 46580
26 Ga0265337_1029538 3300028556 Bacteria 1638
27 Ga0265326_10009832 3300028558 Bacteria 2855
28 Ga0265319_1000040 3300028563 Bacteria 112246
29 Ga0265319_1001547 3300028563 Bacteria 13588
30 Ga0265319_1003334 3300028563 Bacteria 8436
31 Ga0265334_10011328 3300028573 Bacteria 3756
32 Ga0265334_10073557 3300028573 Bacteria 1269
33 Ga0265318_10000032 3300028577 Bacteria 143847
34 Ga0265318_10000844 3300028577 Bacteria 20145
35 Ga0265318_10002823 3300028577 Bacteria 9065
36 Ga0265318_10005836 3300028577 Bacteria 5738
37 Ga0265318_10006306 3300028577 Bacteria 5477
38 Ga0265318_10017341 3300028577 Bacteria 2958
39 Ga0265323_10000064 3300028653 Bacteria 57250
40 Ga0265323_10001066 3300028653 Bacteria 14201
41 Ga0265323_10009440 3300028653 Bacteria 3985
42 Ga0265323_10090995 3300028653 Unclassified 1019
43 Ga0265322_10000649 3300028654 Bacteria 13069
44 Ga0265322_10001605 3300028654 Bacteria 7235
45 Ga0265338_10000098 3300028800 Bacteria 159918
46 Ga0265338_10000505 3300028800 Bacteria 69700
47 Ga0265338_10086495 3300028800 Bacteria 2609
48 Ga0265324_10000039 3300029957 Bacteria 118772
49 Ga0265324_10002823 3300029957 Bacteria 8558
50 Ga0265324_10021879 3300029957 Unclassified 2291
51 Ga0265330_10030286 3300031235 Bacteria 2431
52 Ga0265330_10053393 3300031235 Bacteria 1769
53 Ga0265328_10005726 3300031239 Bacteria 5309
54 Ga0265328_10060904 3300031239 Unclassified 1386
55 Ga0265320_10000071 3300031240 Bacteria 89794
56 Ga0265320_10000900 3300031240 Bacteria 22353
57 Ga0265320_10002049 3300031240 Bacteria 14199
58 Ga0265320_10012550 3300031240 Bacteria 4925
59 Ga0265320_10019519 3300031240 Bacteria 3703
60 Ga0265320_10041656 3300031240 Bacteria 2282
61 Ga0265320_10041955 3300031240 Bacteria 2273
62 Ga0265320_10046238 3300031240 Bacteria 2134
63 Ga0265320_10068053 3300031240 Bacteria 1683
64 Ga0265325_10012902 3300031241 Bacteria 4766
65 Ga0265325_10018010 3300031241 Bacteria 3919
66 Ga0265339_10016998 3300031249 Bacteria 4318
67 Ga0265331_10001795 3300031250 Bacteria 15279
68 Ga0265331_10046380 3300031250 Bacteria 2094
69 Ga0265331_10120923 3300031250 Bacteria 1197
70 Ga0265327_10000061 3300031251 Bacteria 234364
71 Ga0265327_10000066 3300031251 Bacteria 221705
72 Ga0265327_10001302 3300031251 Bacteria 32638
73 Ga0265327_10001524 3300031251 Bacteria 28621
74 Ga0265327_10005708 3300031251 Bacteria 10270
75 Ga0265327_10011725 3300031251 Bacteria 6005
76 Ga0265327_10100239 3300031251 Bacteria 1398
77 Ga0265316_10001079 3300031344 Bacteria 29504
78 Ga0265316_10014096 3300031344 Bacteria 7054
79 Ga0265316_10017890 3300031344 Bacteria 6109
80 Ga0265316_10027295 3300031344 Bacteria 4730
81 Ga0265316_10067942 3300031344 Bacteria 2755
82 Ga0265316_10201627 3300031344 Unclassified 1474
83 Ga0307408_100000093 3300031548 Bacteria 98443
84 Ga0265313_10000350 3300031595 Bacteria 50178
85 Ga0265313_10000927 3300031595 Bacteria 29203
86 Ga0265313_10001657 3300031595 Bacteria 20646
87 Ga0265313_10006250 3300031595 Bacteria 8496
88 Ga0265313_10009024 3300031595 Bacteria 6536
89 Ga0265313_10024656 3300031595 Unclassified 3208
90 Ga0265313_10037104 3300031595 Bacteria 2440
91 Ga0307508_10000084 3300031616 Bacteria 111000
92 Ga0265314_10000072 3300031711 Bacteria 149041
93 Ga0265314_10001488 3300031711 Bacteria 26064
94 Ga0265314_10003079 3300031711 Bacteria 16442
95 Ga0265314_10009942 3300031711 Bacteria 7977
96 Ga0265314_10044692 3300031711 Bacteria 3137
97 Ga0265314_10063510 3300031711 Bacteria 2504
98 Ga0265342_10010317 3300031712 Bacteria 6494
99 Ga0265342_10013573 3300031712 Bacteria 5457
100 Ga0265342_10017365 3300031712 Bacteria 4682
101 Ga0265342_10048161 3300031712 Bacteria 2556
102 Ga0307410_10000495 3300031852 Bacteria 16007
103 Ga0307407_10018162 3300031903 Bacteria 3549
104 Ga0307409_100000097 3300031995 Bacteria 31926
105 Ga0307416_100000139 3300032002 Bacteria 42661
106 Ga0307416_100390470 3300032002 Bacteria 1425
107 Ga0307414_10223323 3300032004 Bacteria 1548
108 Ga0373935_0059748 3300035692 Unclassified 2438
109 Ga0373933_0076307 3300035724 Bacteria 2047
110 Ga0395905_0000026 3300037471 Bacteria 315051
111 Ga0439431_0025902 3300041997 Bacteria 1435
112 Ga0451577_0000017 3300042876 Bacteria 523453
113 Ga0466969_0063875 3300044656 Bacteria 1783
114 Ga0453683_0001810 3300044673 Bacteria 17659
115 Ga0466961_0156614 3300044693 Bacteria 1421
116 Ga0453684_0009998 3300044712 Bacteria 16346
117 Ga0453684_0047496 3300044712 Bacteria 5691
118 Ga0453684_0106181 3300044712 Bacteria 3423
119 Ga0453684_0162053 3300044712 Bacteria 2644
120 Ga0451576_0000052 3300045051 Bacteria 310414
121 Ga0451576_0001237 3300045051 Bacteria 45066
122 Ga0451576_0003063 3300045051 Bacteria 23511
123 Ga0451576_0098507 3300045051 Bacteria 3041
124 Ga0451576_0262937 3300045051 Bacteria 1804
125 Ga0495651_0130411 3300046462 Unclassified 1836
126 Ga0501031_0003703 3300049568 Bacteria 9832
127 Ga0501032_0000568 3300049569 Bacteria 29936
128 Ga0501032_0000961 3300049569 Bacteria 23289
129 Ga0501032_0140532 3300049569 Unclassified 1590
130 Ga0501033_0000873 3300049570 Bacteria 27545
131 Ga0501036_0014682 3300049572 Bacteria 6528
132 Ga0501036_0015949 3300049572 Bacteria 6275
133 Ga0501037_0019387 3300049573 Bacteria 5017
134 Ga0501038_0096498 3300049574 Bacteria 2467
135 Ga0501038_0124282 3300049574 Bacteria 2125
136 Ga0501040_0274947 3300049576 Bacteria 1203
137 Ga0501046_0002902 3300049580 Bacteria 15895
138 Ga0501046_0006496 3300049580 Bacteria 10341
139 Ga0501046_0008892 3300049580 Bacteria 8722
140 Ga0501046_0031791 3300049580 Bacteria 4276
141 Ga0501047_0004280 3300049581 Bacteria 13438
142 Ga0501047_0011599 3300049581 Bacteria 8340
143 Ga0501047_0045542 3300049581 Bacteria 4242
144 Ga0501048_0040124 3300049582 Bacteria 3355
145 Ga0501070_0090994 3300049586 Bacteria 2525
146 Ga0501070_0512573 3300049586 Bacteria 963
147 Ga0501080_0059965 3300049742 Bacteria 3541
148 Ga0501083_0000650 3300049744 Bacteria 22479
149 Ga0501083_0003606 3300049744 Bacteria 10855
150 Ga0501083_0081756 3300049744 Bacteria 2141
151 Ga0501035_0001152 3300049822 Bacteria 27641
152 Ga0501035_0005817 3300049822 Bacteria 11623
153 Ga0501035_0045709 3300049822 Bacteria 3939
154 Ga0501044_0001466 3300049823 Bacteria 27696
155 Ga0501044_0009114 3300049823 Bacteria 10840
156 Ga0501044_0014307 3300049823 Bacteria 8564
157 Ga0501044_0016566 3300049823 Bacteria 7910
158 Ga0500568_0034303 3300053139 Bacteria 2077
159 Ga0500588_0008497 3300053146 Bacteria 2402
160 Ga0265330_10091548
161 rootH2_10030696
162 rootL2_10073071
163 rootL2_10372107
164 rootH1_10011846
165 rootH1_10168664
166 Ga0070683_100085165
167 Ga0070670_100283144
168 Ga0068869_100004131
169 Ga0068868_100050456
170 Ga0068867_100005667
171 Ga0070679_100030845
172 Ga0068855_100247534
173 Ga0068856_100019616
174 Ga0097621_100001673
175 Ga0068871_100002771
176 Ga0068865_100163974
177 Ga0163163_10373723
178 Ga0207705_10115230
179 Ga0207652_10074913
180 Ga0207689_10008807
181 Ga0207661_10006575
182 Ga0207677_10061209
183 Ga0207648_10003192
184 Ga0265337_1000076
185 Ga0265337_1029538
186 Ga0265326_10009832
187 Ga0265319_1000040
188 Ga0265319_1001547
189 Ga0265319_1003334
190 Ga0265334_10011328
191 Ga0265334_10073557
192 Ga0265318_10000032
193 Ga0265318_10000844
194 Ga0265318_10002823
195 Ga0265318_10005836
196 Ga0265318_10006306
197 Ga0265318_10017341
198 Ga0265323_10000064
199 Ga0265323_10001066
200 Ga0265323_10009440
201 Ga0265323_10090995
202 Ga0265322_10000649
203 Ga0265322_10001605
204 Ga0265338_10000098
205 Ga0265338_10000505
206 Ga0265338_10086495
207 Ga0265324_10000039
208 Ga0265324_10002823
209 Ga0265324_10021879
210 Ga0265330_10030286
211 Ga0265330_10053393
212 Ga0265328_10005726
213 Ga0265328_10060904
214 Ga0265320_10000071
215 Ga0265320_10000900
216 Ga0265320_10002049
217 Ga0265320_10012550
218 Ga0265320_10019519
219 Ga0265320_10041656
220 Ga0265320_10041955
221 Ga0265320_10046238
222 Ga0265320_10068053
223 Ga0265325_10012902
224 Ga0265325_10018010
225 Ga0265339_10016998
226 Ga0265331_10001795
227 Ga0265331_10046380
228 Ga0265331_10120923
229 Ga0265327_10000061
230 Ga0265327_10000066
231 Ga0265327_10001302
232 Ga0265327_10001524
233 Ga0265327_10005708
234 Ga0265327_10011725
235 Ga0265327_10100239
236 Ga0265316_10001079
237 Ga0265316_10014096
238 Ga0265316_10017890
239 Ga0265316_10027295
240 Ga0265316_10067942
241 Ga0265316_10201627
242 Ga0307408_100000093
243 Ga0265313_10000350
244 Ga0265313_10000927
245 Ga0265313_10001657
246 Ga0265313_10006250
247 Ga0265313_10009024
248 Ga0265313_10024656
249 Ga0265313_10037104
250 Ga0307508_10000084
251 Ga0265314_10000072
252 Ga0265314_10001488
253 Ga0265314_10003079
254 Ga0265314_10009942
255 Ga0265314_10044692
256 Ga0265314_10063510
257 Ga0265342_10010317
258 Ga0265342_10013573
259 Ga0265342_10017365
260 Ga0265342_10048161
261 Ga0307410_10000495
262 Ga0307407_10018162
263 Ga0307409_100000097
264 Ga0307416_100000139
265 Ga0307416_100390470
266 Ga0307414_10223323
267 Ga0373935_0059748
268 Ga0373933_0076307
269 Ga0395905_0000026
270 Ga0439431_0025902
271 Ga0451577_0000017
272 Ga0466969_0063875
273 Ga0453683_0001810
274 Ga0466961_0156614
275 Ga0453684_0009998
276 Ga0453684_0047496
277 Ga0453684_0106181
278 Ga0453684_0162053
279 Ga0451576_0000052
280 Ga0451576_0001237
281 Ga0451576_0003063
282 Ga0451576_0098507
283 Ga0451576_0262937
284 Ga0495651_0130411
285 Ga0501031_0003703
286 Ga0501032_0000568
287 Ga0501032_0000961
288 Ga0501032_0140532
289 Ga0501033_0000873
290 Ga0501036_0014682
291 Ga0501036_0015949
292 Ga0501037_0019387
293 Ga0501038_0096498
294 Ga0501038_0124282
295 Ga0501040_0274947
296 Ga0501046_0002902
297 Ga0501046_0006496
298 Ga0501046_0008892
299 Ga0501046_0031791
300 Ga0501047_0004280
301 Ga0501047_0011599
302 Ga0501047_0045542
303 Ga0501048_0040124
304 Ga0501070_0090994
305 Ga0501070_0512573
306 Ga0501080_0059965
307 Ga0501083_0000650
308 Ga0501083_0003606
309 Ga0501083_0081756
310 Ga0501035_0001152
311 Ga0501035_0005817
312 Ga0501035_0045709
313 Ga0501044_0001466
314 Ga0501044_0009114
315 Ga0501044_0014307
316 Ga0501044_0016566
317 Ga0500568_0034303
318 Ga0500588_0008497

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01869

BcrAD_BadFG

BadF/BadG/BcrA/BcrD ATPase family

32

295

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e2o-assembly1.cif.gz_A crystal structure of sulfolobus tokodaii hexokinase in complex with glucose 0.8717 5 314
2e2o-assembly1.cif.gz_A crystal structure of sulfolobus tokodaii hexokinase in complex with glucose 0.8368 5 314
1zbs-assembly1.cif.gz_A-2 crystal structure of the putative n-acetylglucosamine kinase (pg1100) from porphyromonas gingivalis, northeast structural genomics target pgr18 0.8111 8 314
1zc6-assembly1.cif.gz_A crystal structure of putative n-acetylglucosamine kinase from chromobacterium violaceum. northeast structural genomics target cvr23. 0.8101 3 312
2ch5-assembly2.cif.gz_C crystal structure of human n-acetylglucosamine kinase in complex with n-acetylglucosamine 0.8064 4 310
ID Description Score Start End Superfamily
af_A0A0P0WJI6_2_100_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.9166 16 33 2.60.40.150
2e2nA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8782 114 297 3.30.420.40
2e2nA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8639 114 297 3.30.420.40
af_Q6ZF69_24_142_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.85 5 110 3.30.420.40
af_A0A1D6L5M8_49_184_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8418 5 128 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A651HBN2-F1-model_v4 ATPase 0.928 3 315
AF-A0A496PV73-F1-model_v4 ATPase 0.9181 3 315
AF-A0A6N6PQ38-F1-model_v4 deleted 0.9139 5 315
AF-A0A3A0A3J8-F1-model_v4 ATPase BadF/BadG/BcrA/BcrD type domain-containing protein 0.912 3 79
AF-A0A6N6PQ38-F1-model_v4 deleted 0.9081 5 315

Map