F232466

General Info

Members Datasets Scaffolds Average Seq Length
159 101 159 383

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10050424|Ga0265338_100504242
Length 403
Sequence MLLRNLQIVSDNSITDILVKGDKIDTVSNYIGNPVEPDVVDFDRAIAFPGLINSHDHLDFNLFPRLGNRLYNNYVEWSTDIHKQNKDVINRVLKVPEHLRVQWGIYKNLLNGVTTVVNHGKKIAADNKLVTVIQNVRSLHSAQLEKYWKLKLNDPLAGTQPFVIHAGEGIDYLSRTEIDNILRWNLFKRDIVAVHGIAMNERQAAGFKGLIWCPDSNYFLIGETAQVKKLAQFTDIVFGTDSTLSAGWNIWDQLRLARSEHVVSDRDLYYMSNTGPADLWQLKGSGKLERSYDADIVIARRKRNADGYDAYYSLNPEDILLVIYKGAIRLFDAELLEQLNYNHNLTGDFSRISVNGCTKFVYGDLPGLAQQIRSYYADAWFPFESIATSNEADAPKYVKHSHR

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
54 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
93 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
94 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
95 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
96 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
99 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
100 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
101 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.61
Nodule 0
Rhizoplane 0
Rhizosphere 74.84
Stem 0
Stem Tuber 0
Unclassified 7.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000290 3300001989 Bacteria 16893
2 JGI25162J39368_1000927 3300002737 Bacteria 18836
3 JGI25157J39369_1003525 3300002741 Bacteria 3158
4 JGI25164J39214_1000935 3300002772 Bacteria 9516
5 JGI25165J46597_1000665 3300003214 Bacteria 27746
6 rootH2_10019366 3300003320 Bacteria 12163
7 rootH2_10264703 3300003320 Bacteria 1579
8 rootH1_10001370 3300003323 Bacteria 113238
9 rootH1_10053598 3300003323 Bacteria 4558
10 rootH1_10198216 3300003323 Bacteria 2050
11 JGI25160J50197_1004596 3300003354 Bacteria 5940
12 Ga0055526_1003876 3300003771 Bacteria 9274
13 Ga0055526_1014360 3300003771 Bacteria 3265
14 Ga0055528_1000188 3300003790 Bacteria 52620
15 Ga0055530_10004500 3300003791 Bacteria 7142
16 Ga0055531_10010098 3300003794 Bacteria 4739
17 Ga0058862_12462765 3300004803 Unclassified 1563
18 Ga0065165_1000128 3300005262 Bacteria 129513
19 Ga0070658_10058440 3300005327 Bacteria 3139
20 Ga0070658_10206835 3300005327 Bacteria 1657
21 Ga0070683_100018241 3300005329 Bacteria 6212
22 Ga0070680_100000217 3300005336 Bacteria 37953
23 Ga0070680_100007475 3300005336 Bacteria 8334
24 Ga0070680_100026739 3300005336 Bacteria 4615
25 Ga0070682_100000066 3300005337 Bacteria 98643
26 Ga0070682_100000542 3300005337 Bacteria 23403
27 Ga0070660_100004213 3300005339 Bacteria 9926
28 Ga0070691_10000127 3300005341 Bacteria 23281
29 Ga0070661_100085862 3300005344 Bacteria 2326
30 Ga0070659_100061145 3300005366 Bacteria 2976
31 Ga0070659_100309888 3300005366 Bacteria 1318
32 Ga0070681_10007556 3300005458 Bacteria 10621
33 Ga0070681_10024956 3300005458 Bacteria 6014
34 Ga0070698_100009972 3300005471 Bacteria 10156
35 Ga0070679_100000230 3300005530 Bacteria 46120
36 Ga0070679_100010523 3300005530 Bacteria 8776
37 Ga0070679_100019710 3300005530 Bacteria 6564
38 Ga0070679_100070871 3300005530 Bacteria 3476
39 Ga0070679_100135953 3300005530 Bacteria 2439
40 Ga0070684_100006083 3300005535 Bacteria 9293
41 Ga0068853_100039993 3300005539 Bacteria 3999
42 Ga0068853_100052740 3300005539 Bacteria 3503
43 Ga0070693_100004081 3300005547 Bacteria 6875
44 Ga0068855_100009017 3300005563 Bacteria 12054
45 Ga0068855_100030419 3300005563 Bacteria 6459
46 Ga0068855_100043700 3300005563 Bacteria 5306
47 Ga0068855_100054640 3300005563 Bacteria 4693
48 Ga0070664_100004210 3300005564 Bacteria 11567
49 Ga0070664_100037982 3300005564 Bacteria 4051
50 Ga0068857_100298346 3300005577 Bacteria 1485
51 Ga0068856_100182254 3300005614 Bacteria 2113
52 Ga0068864_100105197 3300005618 Bacteria 2508
53 Ga0068860_100049000 3300005843 Bacteria 4026
54 Ga0068862_100092429 3300005844 Bacteria 2637
55 Ga0081540_1005052 3300005983 Bacteria 9898
56 Ga0070712_100044734 3300006175 Unclassified 3054
57 Ga0075428_100071385 3300006844 Bacteria 3795
58 Ga0105240_10008153 3300009093 Bacteria 15023
59 Ga0105241_10000147 3300009174 Bacteria 50428
60 Ga0105237_10002944 3300009545 Bacteria 20611
61 Ga0105237_10005113 3300009545 Bacteria 14880
62 Ga0105238_10389819 3300009551 Unclassified 1385
63 Ga0105249_10045003 3300009553 Bacteria 4014
64 Ga0105249_10173619 3300009553 Bacteria 2092
65 Ga0105239_10000414 3300010375 Bacteria 62261
66 Ga0105239_10006170 3300010375 Bacteria 13947
67 Ga0157373_10000057 3300013100 Bacteria 99697
68 Ga0157373_10000850 3300013100 Bacteria 23716
69 Ga0157371_10000807 3300013102 Bacteria 35968
70 Ga0157371_10002265 3300013102 Bacteria 18548
71 Ga0157371_10009656 3300013102 Bacteria 7586
72 Ga0157371_10010885 3300013102 Bacteria 7054
73 Ga0157371_10025779 3300013102 Bacteria 4281
74 Ga0157371_10265401 3300013102 Bacteria 1238
75 Ga0157370_10001417 3300013104 Bacteria 29766
76 Ga0157370_10013164 3300013104 Bacteria 8532
77 Ga0157370_10177737 3300013104 Bacteria 1978
78 Ga0157369_10014077 3300013105 Bacteria 9039
79 Ga0157369_10137068 3300013105 Bacteria 2591
80 Ga0157369_10139714 3300013105 Bacteria 2563
81 Ga0157372_10007435 3300013307 Bacteria 11649
82 Ga0157372_10015617 3300013307 Bacteria 8142
83 Ga0157372_10035497 3300013307 Bacteria 5489
84 Ga0157372_10039332 3300013307 Bacteria 5219
85 Ga0157372_10055058 3300013307 Bacteria 4441
86 Ga0157372_10184875 3300013307 Bacteria 2413
87 Ga0163163_10300326 3300014325 Unclassified 1658
88 Ga0213876_10000654 3300021384 Bacteria 24937
89 Ga0207427_100187 3300025231 Bacteria 63218
90 Ga0209437_100008 3300025233 Bacteria 921142
91 Ga0209026_1000325 3300025250 Bacteria 49667
92 Ga0209026_1005346 3300025250 Bacteria 3477
93 Ga0209233_1000024 3300025261 Bacteria 695418
94 Ga0209565_1021424 3300025263 Unclassified 1352
95 Ga0209673_1000085 3300025273 Bacteria 215647
96 Ga0209564_1004067 3300025295 Bacteria 9223
97 Ga0209564_1005259 3300025295 Bacteria 7470
98 Ga0209564_1032689 3300025295 Bacteria 1562
99 Ga0209758_1002626 3300025297 Bacteria 17861
100 Ga0209758_1008242 3300025297 Bacteria 6823
101 Ga0209050_1003448 3300025298 Bacteria 11645
102 Ga0207426_1001237 3300025302 Bacteria 22468
103 Ga0209051_1018269 3300025303 Bacteria 3106
104 Ga0209257_1001163 3300025304 Bacteria 33467
105 Ga0207680_10063451 3300025903 Bacteria 2261
106 Ga0207705_10033611 3300025909 Unclassified 3664
107 Ga0207705_10057266 3300025909 Bacteria 2811
108 Ga0207654_10007407 3300025911 Bacteria 5527
109 Ga0207707_10000293 3300025912 Bacteria 53373
110 Ga0207695_10032992 3300025913 Bacteria 5657
111 Ga0207695_10045296 3300025913 Bacteria 4670
112 Ga0207671_10008526 3300025914 Bacteria 8678
113 Ga0207671_10032474 3300025914 Bacteria 3886
114 Ga0207693_10044583 3300025915 Unclassified 3486
115 Ga0207660_10002386 3300025917 Bacteria 12352
116 Ga0207660_10096678 3300025917 Bacteria 2199
117 Ga0207652_10000108 3300025921 Bacteria 90141
118 Ga0207652_10000171 3300025921 Bacteria 69902
119 Ga0207652_10025673 3300025921 Unclassified 4900
120 Ga0207652_10203628 3300025921 Bacteria 1781
121 Ga0207694_10276918 3300025924 Unclassified 1377
122 Ga0207661_10012095 3300025944 Bacteria 6268
123 Ga0207679_10002725 3300025945 Bacteria 10924
124 Ga0207667_10011151 3300025949 Bacteria 10462
125 Ga0207667_10078101 3300025949 Unclassified 3432
126 Ga0207667_10102312 3300025949 Bacteria 2955
127 Ga0207712_10064537 3300025961 Bacteria 2611
128 Ga0207639_10014251 3300026041 Bacteria 5584
129 Ga0207639_10059269 3300026041 Bacteria 2948
130 Ga0207698_10094113 3300026142 Bacteria 2462
131 Ga0207698_10211051 3300026142 Bacteria 1747
132 Ga0268264_10036554 3300028381 Bacteria 4047
133 Ga0265338_10050424 3300028800 Bacteria 3763
134 Ga0265338_10066039 3300028800 Bacteria 3134
135 Ga0265324_10015295 3300029957 Bacteria 2824
136 Ga0265327_10000152 3300031251 Bacteria 149065
137 Ga0265327_10000418 3300031251 Bacteria 77683
138 Ga0307513_10032597 3300031456 Bacteria 5872
139 Ga0307516_10013224 3300031730 Bacteria 8812
140 Ga0307411_10201774 3300032005 Unclassified 1528
141 Ga0395899_0102464 3300037312 Unclassified 2065
142 Ga0395900_0000420 3300037418 Bacteria 61258
143 Ga0395900_0033090 3300037418 Bacteria 5320
144 Ga0395898_0002699 3300037466 Bacteria 20525
145 Ga0395898_0247672 3300037466 Bacteria 1699
146 Ga0395901_0022466 3300038443 Bacteria 6466
147 Ga0395901_0178467 3300038443 Bacteria 2227
148 Ga0436365_0672883 3300039437 Bacteria 113020
149 Ga0495644_0018260 3300046523 Unclassified 2679
150 Ga0495668_0000513 3300046616 Bacteria 48303
151 Ga0495670_0051890 3300046691 Bacteria 2053
152 Ga0495636_0000123 3300047318 Bacteria 32076
153 Ga0495686_0000058 3300047472 Bacteria 240089
154 Ga0495686_0000752 3300047472 Bacteria 42761
155 Ga0501034_0079436 3300049571 Bacteria 3284
156 Ga0500658_0000754 3300053134 Bacteria 13369
157 Ga0500577_0001140 3300053142 Bacteria 6816
158 Ga0500604_0014016 3300053151 Bacteria 2179
159 Ga0500624_000746 3300053157 Bacteria 7919

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021384 Ga0213876_10000654 Ga0213876_100006546 352
2 3300039437 Ga0436365_0672883 Ga0436365_0672883_34578_35684 352
3 3300002741 JGI25157J39369_1003525 JGI25157J39369_10035252 356
4 3300025250 Ga0209026_1000325 Ga0209026_100032540 356
5 3300005843 Ga0068860_100049000 Ga0068860_1000490003 362
6 3300009545 Ga0105237_10005113 Ga0105237_100051132 362
7 3300009551 Ga0105238_10389819 Ga0105238_103898191 362
8 3300010375 Ga0105239_10000414 Ga0105239_1000041433 362
9 3300025903 Ga0207680_10063451 Ga0207680_100634512 362
10 3300025913 Ga0207695_10045296 Ga0207695_100452963 362
11 3300025914 Ga0207671_10032474 Ga0207671_100324743 362
12 3300025924 Ga0207694_10276918 Ga0207694_102769182 362
13 3300028381 Ga0268264_10036554 Ga0268264_100365542 362
14 3300046523 Ga0495644_0018260 Ga0495644_0018260_635_1759 364
15 3300031251 Ga0265327_10000152 Ga0265327_1000015222 365
16 3300025250 Ga0209026_1005346 Ga0209026_10053462 366
17 3300005564 Ga0070664_100037982 Ga0070664_1000379823 368
18 3300005577 Ga0068857_100298346 Ga0068857_1002983462 370
19 3300013105 Ga0157369_10137068 Ga0157369_101370682 370
20 3300005336 Ga0070680_100000217 Ga0070680_10000021718 371
21 3300005337 Ga0070682_100000542 Ga0070682_1000005426 371
22 3300005341 Ga0070691_10000127 Ga0070691_1000012714 371
23 3300005344 Ga0070661_100085862 Ga0070661_1000858621 371
24 3300005458 Ga0070681_10007556 Ga0070681_100075563 371
25 3300005530 Ga0070679_100010523 Ga0070679_1000105235 371
26 3300005539 Ga0068853_100052740 Ga0068853_1000527402 371
27 3300005547 Ga0070693_100004081 Ga0070693_1000040815 371
28 3300009093 Ga0105240_10008153 Ga0105240_100081535 371
29 3300009174 Ga0105241_10000147 Ga0105241_1000014729 371
30 3300013104 Ga0157370_10013164 Ga0157370_100131645 371
31 3300025911 Ga0207654_10007407 Ga0207654_100074075 371
32 3300025912 Ga0207707_10000293 Ga0207707_1000029326 371
33 3300025913 Ga0207695_10032992 Ga0207695_100329923 371
34 3300025917 Ga0207660_10002386 Ga0207660_100023864 371
35 3300025921 Ga0207652_10025673 Ga0207652_100256733 371
36 3300025949 Ga0207667_10078101 Ga0207667_100781012 371
37 3300026041 Ga0207639_10059269 Ga0207639_100592692 371
38 3300003320 rootH2_10264703 rootH2_102647032 372
39 3300003323 rootH1_10198216 rootH1_101982162 372
40 3300013100 Ga0157373_10000057 Ga0157373_1000005724 372
41 3300013307 Ga0157372_10007435 Ga0157372_100074356 372
42 3300047318 Ga0495636_0000123 Ga0495636_0000123_25811_26956 373
43 3300005329 Ga0070683_100018241 Ga0070683_1000182415 374
44 3300005535 Ga0070684_100006083 Ga0070684_1000060838 374
45 3300005564 Ga0070664_100004210 Ga0070664_1000042108 374
46 3300025944 Ga0207661_10012095 Ga0207661_100120954 374
47 3300025945 Ga0207679_10002725 Ga0207679_100027256 374
48 3300005983 Ga0081540_1005052 Ga0081540_10050525 375
49 3300046691 Ga0495670_0051890 Ga0495670_0051890_534_1700 375
50 3300053134 Ga0500658_0000754 Ga0500658_0000754_3091_4227 376
51 3300053142 Ga0500577_0001140 Ga0500577_0001140_1267_2403 376
52 3300047472 Ga0495686_0000752 Ga0495686_0000752_22272_23423 378
53 3300005563 Ga0068855_100009017 Ga0068855_1000090177 379
54 3300025949 Ga0207667_10011151 Ga0207667_100111515 379
55 3300002737 JGI25162J39368_1000927 JGI25162J39368_100092715 380
56 3300002772 JGI25164J39214_1000935 JGI25164J39214_10009355 380
57 3300003214 JGI25165J46597_1000665 JGI25165J46597_100066519 380
58 3300003323 rootH1_10001370 rootH1_1000137036 380
59 3300003323 rootH1_10053598 rootH1_100535985 380
60 3300005327 Ga0070658_10206835 Ga0070658_102068352 380
61 3300005336 Ga0070680_100007475 Ga0070680_1000074753 380
62 3300005458 Ga0070681_10024956 Ga0070681_100249563 380
63 3300005530 Ga0070679_100135953 Ga0070679_1001359532 380
64 3300005563 Ga0068855_100043700 Ga0068855_1000437003 380
65 3300005614 Ga0068856_100182254 Ga0068856_1001822542 380
66 3300013102 Ga0157371_10010885 Ga0157371_100108852 380
67 3300013102 Ga0157371_10025779 Ga0157371_100257792 380
68 3300013104 Ga0157370_10177737 Ga0157370_101777372 380
69 3300013105 Ga0157369_10014077 Ga0157369_100140778 380
70 3300013307 Ga0157372_10035497 Ga0157372_100354973 380
71 3300013307 Ga0157372_10039332 Ga0157372_100393322 380
72 3300025231 Ga0207427_100187 Ga0207427_1001872 380
73 3300025233 Ga0209437_100008 Ga0209437_100008609 380
74 3300025261 Ga0209233_1000024 Ga0209233_100002448 380
75 3300025909 Ga0207705_10033611 Ga0207705_100336112 380
76 3300025921 Ga0207652_10000171 Ga0207652_1000017157 380
77 3300025949 Ga0207667_10102312 Ga0207667_101023122 380
78 3300026142 Ga0207698_10211051 Ga0207698_102110511 380
79 3300028800 Ga0265338_10066039 Ga0265338_100660393 380
80 3300037312 Ga0395899_0102464 Ga0395899_0102464_559_1716 380
81 3300038443 Ga0395901_0022466 Ga0395901_0022466_576_1733 380
82 3300003320 rootH2_10019366 rootH2_100193669 381
83 3300005336 Ga0070680_100026739 Ga0070680_1000267395 381
84 3300005337 Ga0070682_100000066 Ga0070682_10000006662 381
85 3300005530 Ga0070679_100019710 Ga0070679_1000197106 381
86 3300005539 Ga0068853_100039993 Ga0068853_1000399931 381
87 3300005563 Ga0068855_100030419 Ga0068855_1000304195 381
88 3300006844 Ga0075428_100071385 Ga0075428_1000713853 381
89 3300013100 Ga0157373_10000850 Ga0157373_1000085017 381
90 3300013102 Ga0157371_10000807 Ga0157371_1000080713 381
91 3300013102 Ga0157371_10002265 Ga0157371_100022651 381
92 3300013102 Ga0157371_10265401 Ga0157371_102654011 381
93 3300013105 Ga0157369_10139714 Ga0157369_101397143 381
94 3300013307 Ga0157372_10015617 Ga0157372_100156177 381
95 3300013307 Ga0157372_10055058 Ga0157372_100550584 381
96 3300013307 Ga0157372_10184875 Ga0157372_101848752 381
97 3300014325 Ga0163163_10300326 Ga0163163_103003261 381
98 3300025917 Ga0207660_10096678 Ga0207660_100966782 381
99 3300025921 Ga0207652_10203628 Ga0207652_102036282 381
100 3300026041 Ga0207639_10014251 Ga0207639_100142514 381
101 3300026142 Ga0207698_10094113 Ga0207698_100941132 381
102 3300031251 Ga0265327_10000418 Ga0265327_1000041810 381
103 3300032005 Ga0307411_10201774 Ga0307411_102017742 381
104 3300053157 Ga0500624_000746 Ga0500624_000746_2353_3525 381
105 3300004803 Ga0058862_12462765 Ga0058862_124627652 382
106 3300005327 Ga0070658_10058440 Ga0070658_100584402 382
107 3300005339 Ga0070660_100004213 Ga0070660_1000042137 382
108 3300005366 Ga0070659_100061145 Ga0070659_1000611452 382
109 3300005366 Ga0070659_100309888 Ga0070659_1003098881 382
110 3300005471 Ga0070698_100009972 Ga0070698_1000099728 382
111 3300005530 Ga0070679_100000230 Ga0070679_10000023041 382
112 3300005530 Ga0070679_100070871 Ga0070679_1000708713 382
113 3300005563 Ga0068855_100054640 Ga0068855_1000546403 382
114 3300005618 Ga0068864_100105197 Ga0068864_1001051972 382
115 3300005844 Ga0068862_100092429 Ga0068862_1000924292 382
116 3300009545 Ga0105237_10002944 Ga0105237_100029445 382
117 3300009553 Ga0105249_10045003 Ga0105249_100450032 382
118 3300009553 Ga0105249_10173619 Ga0105249_101736192 382
119 3300010375 Ga0105239_10006170 Ga0105239_1000617012 382
120 3300013102 Ga0157371_10009656 Ga0157371_100096565 382
121 3300013104 Ga0157370_10001417 Ga0157370_1000141711 382
122 3300025909 Ga0207705_10057266 Ga0207705_100572662 382
123 3300025914 Ga0207671_10008526 Ga0207671_100085265 382
124 3300025921 Ga0207652_10000108 Ga0207652_1000010867 382
125 3300025961 Ga0207712_10064537 Ga0207712_100645372 382
126 3300037418 Ga0395900_0000420 Ga0395900_0000420_15945_17108 382
127 3300037418 Ga0395900_0033090 Ga0395900_0033090_1739_2905 382
128 3300037466 Ga0395898_0002699 Ga0395898_0002699_5448_6611 382
129 3300037466 Ga0395898_0247672 Ga0395898_0247672_198_1364 382
130 3300038443 Ga0395901_0178467 Ga0395901_0178467_797_1960 382
131 3300047472 Ga0495686_0000058 Ga0495686_0000058_7591_8757 382
132 3300049571 Ga0501034_0079436 Ga0501034_0079436_1905_3068 382
133 3300006175 Ga0070712_100044734 Ga0070712_1000447342 383
134 3300025915 Ga0207693_10044583 Ga0207693_100445832 383
135 3300028800 Ga0265338_10050424 Ga0265338_100504242 383
136 3300029957 Ga0265324_10015295 Ga0265324_100152952 383
137 3300031456 Ga0307513_10032597 Ga0307513_100325973 383
138 3300031730 Ga0307516_10013224 Ga0307516_100132245 383
139 3300003354 JGI25160J50197_1004596 JGI25160J50197_10045966 384
140 3300003771 Ga0055526_1003876 Ga0055526_10038767 384
141 3300003790 Ga0055528_1000188 Ga0055528_100018828 384
142 3300003791 Ga0055530_10004500 Ga0055530_100045005 384
143 3300003794 Ga0055531_10010098 Ga0055531_100100985 384
144 3300005262 Ga0065165_1000128 Ga0065165_100012870 384
145 3300025263 Ga0209565_1021424 Ga0209565_10214241 384
146 3300025273 Ga0209673_1000085 Ga0209673_100008563 384
147 3300025295 Ga0209564_1004067 Ga0209564_10040673 384
148 3300025298 Ga0209050_1003448 Ga0209050_10034485 384
149 3300025302 Ga0207426_1001237 Ga0207426_100123716 384
150 3300025303 Ga0209051_1018269 Ga0209051_10182694 384
151 3300025304 Ga0209257_1001163 Ga0209257_100116313 384
152 3300046616 Ga0495668_0000513 Ga0495668_0000513_32076_33242 384
153 3300053151 Ga0500604_0014016 Ga0500604_0014016_58_1224 384
154 3300001989 JGI24739J22299_10000290 JGI24739J22299_1000029011 385
155 3300003771 Ga0055526_1014360 Ga0055526_10143605 385
156 3300025295 Ga0209564_1005259 Ga0209564_10052596 385
157 3300025295 Ga0209564_1032689 Ga0209564_10326892 385
158 3300025297 Ga0209758_1002626 Ga0209758_10026268 385
159 3300025297 Ga0209758_1008242 Ga0209758_10082426 385

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v7p-assembly1.cif.gz_A-2 crystal structure of amidohydrolase nis_0429 (target efi-500396) from nitratiruptor sp. sb155-2 0.7679 1 329
4m51-assembly1.cif.gz_A-2 crystal structure of amidohydrolase nis_0429 (ser145ala mutant) from nitratiruptor sp. sb155-2 0.7601 1 329
4f0r-assembly1.cif.gz_A crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) bound zn and 5'-methylthioadenosine (unproductive complex) 0.7492 2 380
4f0r-assembly1.cif.gz_A crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) bound zn and 5'-methylthioadenosine (unproductive complex) 0.7367 2 380
4gbd-assembly1.cif.gz_B crystal structure of adenosine deaminase from pseudomonas aeruginosa pao1 with bound zn and methylthio-coformycin 0.732 2 380
ID Description Score Start End Superfamily
af_Q58110_154_346_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8207 135 295 3.20.20.140
2r8cA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.7403 285 329 2.30.40.10
af_I1NJF1_13_436_3.30.390.80 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;DNA repair protein Rad52/59/22 0.7206 1 329 3.30.390.80
af_Q07729_95_405_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7101 50 287 3.20.20.140
3feqK01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.7034 285 330 2.30.40.10
ID Description Score Start End GO Terms
AF-A0A522RKD8-F1-model_v4 Amidohydrolase-related domain-containing protein 0.967 3 384 GO:0016810
AF-A0A3M9NLU1-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9661 3 385 GO:0016810
AF-A0A7Y3RZ01-F1-model_v4 deleted 0.9656 59 194
AF-A0A2V8K911-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9642 1 385 GO:0016810
AF-A0A5B8W8L7-F1-model_v4 Amidohydrolase family protein 0.9598 3 385 GO:0016810

Feature Viewer

pLDDT pTM Quality
94.13 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map