F231930

General Info

Members Datasets Scaffolds Average Seq Length
159 102 318 336

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10021916|Ga0075433_100219164
Length 348
Sequence LKAVRFHQHGGVDVLRYEDVPAPQPAPGEALVRVRACALNHLDLWQRRGLPHVTFPMPHISGSDVSGEVVDGGARGDVRPGTRVMLQPGVSCGFCDACLSGRDNECPQYEVLGYRNHPGGYAEYVKVPAQNLIPIPDHVSFVDAAAFPLTFVTAWHMLVTKARVRRGDDVLVLAGGSGVGQAAIQVAVMHGARVIATAGSDEKLERARELGASDVIHHHRQDIAEEIKRLTNRRGVDVVIEHVGEATWPKSVRSLARGGRLVTCGATTGAKGALDLTALFAKQLSILGSYMGPKGELLEAARLFFAGRLKPAVDRVFPLEQAAQAQQRLEQSGQFGKIVLDVRCDSSS

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
72 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
77 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
78 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
79 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
80 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
81 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
85 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
86 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
87 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
88 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
89 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
90 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
91 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
92 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
93 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
94 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
95 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
96 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
97 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
98 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
99 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
100 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
101 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
102 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.03
Nodule 0
Rhizoplane 0
Rhizosphere 94.34
Stem 0
Stem Tuber 0
Unclassified 12.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10021916 3300006852 Bacteria 5361
2 Ga0065707_10005440 3300005295 Bacteria 5612
3 Ga0068869_100128026 3300005334 Bacteria 1949
4 Ga0070689_100078946 3300005340 Archaea 2581
5 Ga0070689_100160371 3300005340 Unclassified 1818
6 Ga0070689_100264215 3300005340 Unclassified 1423
7 Ga0070661_100135637 3300005344 Bacteria 1852
8 Ga0070692_10201073 3300005345 Bacteria 1167
9 Ga0070669_100009753 3300005353 Bacteria 6838
10 Ga0070669_100065558 3300005353 Bacteria 2676
11 Ga0070675_100168976 3300005354 Bacteria 1885
12 Ga0070674_100010020 3300005356 Bacteria 5705
13 Ga0070674_100013930 3300005356 Bacteria 4985
14 Ga0070673_100017454 3300005364 Bacteria 5104
15 Ga0070659_100334539 3300005366 Bacteria 1268
16 Ga0070701_10028219 3300005438 Bacteria 2758
17 Ga0070701_10160632 3300005438 Unclassified 1301
18 Ga0070705_100137811 3300005440 Unclassified 1602
19 Ga0070700_100001296 3300005441 Bacteria 12428
20 Ga0068867_100025779 3300005459 Bacteria 4219
21 Ga0070698_100016809 3300005471 Bacteria 7718
22 Ga0070699_100008661 3300005518 Bacteria 8817
23 Ga0070699_100024262 3300005518 Bacteria 5225
24 Ga0070697_100000095 3300005536 Bacteria 74109
25 Ga0070697_100108493 3300005536 Bacteria 2311
26 Ga0070697_100113072 3300005536 Archaea 2265
27 Ga0070672_100206616 3300005543 Bacteria 1643
28 Ga0070695_100100915 3300005545 Bacteria 1943
29 Ga0070704_100050087 3300005549 Bacteria 2933
30 Ga0068855_100131126 3300005563 Bacteria 2863
31 Ga0068854_100012459 3300005578 Bacteria 5570
32 Ga0068854_100352979 3300005578 Bacteria 1204
33 Ga0070702_100010199 3300005615 Bacteria 4619
34 Ga0068859_100228642 3300005617 Bacteria 1948
35 Ga0068866_10055613 3300005718 Bacteria 2033
36 Ga0068861_100079151 3300005719 Bacteria 2569
37 Ga0068862_100021621 3300005844 Bacteria 5379
38 Ga0068862_100127129 3300005844 Bacteria 2251
39 Ga0068862_100244893 3300005844 Bacteria 1632
40 Ga0081455_10051196 3300005937 Bacteria 3544
41 Ga0075365_10022234 3300006038 Bacteria 3971
42 Ga0075365_10077307 3300006038 Bacteria 2249
43 Ga0075366_10005028 3300006195 Bacteria 7142
44 Ga0075366_10035854 3300006195 Bacteria 2924
45 Ga0097621_100049335 3300006237 Bacteria 3419
46 Ga0075430_100094513 3300006846 Bacteria 2499
47 Ga0075433_10073839 3300006852 Unclassified 3000
48 Ga0075433_10335385 3300006852 Unclassified 1337
49 Ga0075434_100030002 3300006871 Bacteria 5353
50 Ga0075434_100047233 3300006871 Bacteria 4273
51 Ga0075434_100152223 3300006871 Archaea 2333
52 Ga0075436_100014717 3300006914 Bacteria 5361
53 Ga0075436_100021864 3300006914 Bacteria 4391
54 Ga0075436_100026118 3300006914 Bacteria 4021
55 Ga0075436_100074432 3300006914 Archaea 2351
56 Ga0097620_100228634 3300006931 Bacteria 1948
57 Ga0075435_100000027 3300007076 Bacteria 84051
58 Ga0075435_100320120 3300007076 Archaea 1327
59 Ga0111539_10007456 3300009094 Bacteria 14014
60 Ga0111539_10017590 3300009094 Bacteria 8847
61 Ga0111539_10040659 3300009094 Bacteria 5595
62 Ga0114129_10002577 3300009147 Bacteria 25192
63 Ga0114129_10004671 3300009147 Bacteria 19343
64 Ga0114129_10043758 3300009147 Bacteria 6300
65 Ga0114129_10133116 3300009147 Bacteria 3413
66 Ga0105243_10008347 3300009148 Bacteria 7951
67 Ga0105248_10541732 3300009177 Unclassified 1313
68 Ga0105249_10094370 3300009553 Unclassified 2804
69 Ga0157370_10150650 3300013104 Bacteria 2164
70 Ga0157369_10172000 3300013105 Bacteria 2282
71 Ga0163162_10132860 3300013306 Unclassified 2598
72 Ga0207642_10047289 3300025899 Bacteria 1923
73 Ga0207645_10004214 3300025907 Bacteria 10675
74 Ga0207681_10015615 3300025923 Bacteria 4738
75 Ga0207681_10078949 3300025923 Unclassified 2317
76 Ga0207681_10237421 3300025923 Unclassified 1417
77 Ga0207659_10297519 3300025926 Bacteria 1324
78 Ga0207706_10071382 3300025933 Bacteria 3054
79 Ga0207709_10157374 3300025935 Bacteria 1581
80 Ga0207670_10024284 3300025936 Unclassified 3787
81 Ga0207669_10021928 3300025937 Bacteria 3383
82 Ga0207691_10182330 3300025940 Bacteria 1834
83 Ga0207711_10362516 3300025941 Unclassified 1343
84 Ga0207667_10171753 3300025949 Bacteria 2228
85 Ga0207651_10008762 3300025960 Bacteria 5488
86 Ga0207712_10101818 3300025961 Unclassified 2137
87 Ga0207658_10515568 3300025986 Bacteria 1067
88 Ga0207677_10024461 3300026023 Bacteria 3753
89 Ga0207708_10001028 3300026075 Bacteria 20878
90 Ga0207708_10110104 3300026075 Bacteria 2137
91 Ga0207648_10032487 3300026089 Bacteria 4607
92 Ga0207675_100059606 3300026118 Bacteria 3562
93 Ga0207675_100077987 3300026118 Bacteria 3103
94 Ga0207675_100160522 3300026118 Bacteria 2144
95 Ga0209588_1002327 3300027671 Archaea 5145
96 Ga0209588_1004500 3300027671 Archaea 3936
97 Ga0207428_10036170 3300027907 Bacteria 4030
98 Ga0207428_10090720 3300027907 Bacteria 2373
99 Ga0207428_10110871 3300027907 Bacteria 2112
100 Ga0268265_10004344 3300028380 Bacteria 9851
101 Ga0268265_10005884 3300028380 Bacteria 8357
102 Ga0265338_10014203 3300028800 Bacteria 8892
103 Ga0265338_10062397 3300028800 Bacteria 3257
104 Ga0307405_10035591 3300031731 Bacteria 2975
105 Ga0307413_10064551 3300031824 Bacteria 2276
106 Ga0307416_100242782 3300032002 Bacteria 1747
107 Ga0451853_2428109 3300041512 Bacteria 1369
108 Ga0453683_0003251 3300044673 Bacteria 12082
109 Ga0451576_0037837 3300045051 Bacteria 5109
110 Ga0451576_0283494 3300045051 Bacteria 1732
111 Ga0495592_0179024 3300046454 Bacteria 1445
112 Ga0495653_0052132 3300046463 Unclassified 3137
113 Ga0495639_0170927 3300046475 Bacteria 1055
114 Ga0495621_0049905 3300046539 Bacteria 1494
115 Ga0495656_0331053 3300046615 Bacteria 786
116 Ga0495669_0181305 3300046684 Bacteria 1004
117 Ga0495680_0315861 3300047322 Unclassified 1094
118 Ga0501034_0031197 3300049571 Bacteria 5415
119 Ga0501040_0189090 3300049576 Bacteria 1461
120 Ga0501047_0035938 3300049581 Bacteria 4787
121 Ga0501072_0003421 3300049588 Bacteria 11955
122 Ga0501076_0041460 3300049592 Bacteria 3622
123 Ga0501045_0041004 3300049824 Bacteria 3368
124 nmdc:mga0yw44_212067_c1 3300050492 Unclassified 1281
125 nmdc:mga0yw44_99133_c1 3300050492 Bacteria 1853
126 nmdc:mga0k408_6922_c1 3300050493 Bacteria 6047
127 nmdc:mga06z11_24826_c1 3300050494 Bacteria 2833
128 nmdc:mga05p37_21173_c1 3300050507 Bacteria 7872
129 nmdc:mga05p37_26996_c1 3300050507 Bacteria 6987
130 nmdc:mga05p37_300_c1 3300050507 Bacteria 51798
131 nmdc:mga05p37_6821_c1 3300050507 Bacteria 13458
132 nmdc:mga0qj67_129743_c1 3300050509 Bacteria 2041
133 nmdc:mga08y16_163848_c1 3300050511 Unclassified 2310
134 nmdc:mga08y16_55683_c1 3300050511 Bacteria 4132
135 nmdc:mga08y16_77193_c1 3300050511 Unclassified 3473
136 nmdc:mga0n895_336723_c1 3300050512 Archaea 1529
137 nmdc:mga0n895_3_c1 3300050512 Bacteria 134167
138 nmdc:mga0n895_89102_c1 3300050512 Unclassified 3086
139 nmdc:mga0rr50_198673_c1 3300050513 Bacteria 1647
140 nmdc:mga0rr50_39_c1 3300050513 Bacteria 84395
141 nmdc:mga08x19_243801_c1 3300050514 Bacteria 1239
142 nmdc:mga08x19_48865_c1 3300050514 Bacteria 2711
143 nmdc:mga08x19_73_c1 3300050514 Bacteria 96390
144 nmdc:mga0a205_2746_c1 3300050515 Bacteria 15552
145 nmdc:mga0a205_433169_c1 3300050515 Bacteria 1176
146 Ga0501084_0476478 3300054114 Bacteria 1055
147 Ga0590071_000103 3300059421 Bacteria 24181
148 Ga0590071_000188 3300059421 Bacteria 18034
149 Ga0590071_028246 3300059421 Bacteria 1332
150 Ga0590074_000108 3300059423 Bacteria 9435
151 Ga0590074_000142 3300059423 Bacteria 8545
152 Ga0590075_000120 3300059424 Bacteria 20173
153 Ga0590075_000594 3300059424 Bacteria 9722
154 Ga0590075_014032 3300059424 Bacteria 1956
155 Ga0590077_000230 3300059426 Bacteria 16099
156 Ga0590077_000445 3300059426 Bacteria 11621
157 Ga0590077_004909 3300059426 Bacteria 2736
158 Ga0590077_025639 3300059426 Bacteria 1271
159 Ga0530510_0016632 3300061734 Bacteria 5209
160 Ga0075433_10021916
161 Ga0065707_10005440
162 Ga0068869_100128026
163 Ga0070689_100078946
164 Ga0070689_100160371
165 Ga0070689_100264215
166 Ga0070661_100135637
167 Ga0070692_10201073
168 Ga0070669_100009753
169 Ga0070669_100065558
170 Ga0070675_100168976
171 Ga0070674_100010020
172 Ga0070674_100013930
173 Ga0070673_100017454
174 Ga0070659_100334539
175 Ga0070701_10028219
176 Ga0070701_10160632
177 Ga0070705_100137811
178 Ga0070700_100001296
179 Ga0068867_100025779
180 Ga0070698_100016809
181 Ga0070699_100008661
182 Ga0070699_100024262
183 Ga0070697_100000095
184 Ga0070697_100108493
185 Ga0070697_100113072
186 Ga0070672_100206616
187 Ga0070695_100100915
188 Ga0070704_100050087
189 Ga0068855_100131126
190 Ga0068854_100012459
191 Ga0068854_100352979
192 Ga0070702_100010199
193 Ga0068859_100228642
194 Ga0068866_10055613
195 Ga0068861_100079151
196 Ga0068862_100021621
197 Ga0068862_100127129
198 Ga0068862_100244893
199 Ga0081455_10051196
200 Ga0075365_10022234
201 Ga0075365_10077307
202 Ga0075366_10005028
203 Ga0075366_10035854
204 Ga0097621_100049335
205 Ga0075430_100094513
206 Ga0075433_10073839
207 Ga0075433_10335385
208 Ga0075434_100030002
209 Ga0075434_100047233
210 Ga0075434_100152223
211 Ga0075436_100014717
212 Ga0075436_100021864
213 Ga0075436_100026118
214 Ga0075436_100074432
215 Ga0097620_100228634
216 Ga0075435_100000027
217 Ga0075435_100320120
218 Ga0111539_10007456
219 Ga0111539_10017590
220 Ga0111539_10040659
221 Ga0114129_10002577
222 Ga0114129_10004671
223 Ga0114129_10043758
224 Ga0114129_10133116
225 Ga0105243_10008347
226 Ga0105248_10541732
227 Ga0105249_10094370
228 Ga0157370_10150650
229 Ga0157369_10172000
230 Ga0163162_10132860
231 Ga0207642_10047289
232 Ga0207645_10004214
233 Ga0207681_10015615
234 Ga0207681_10078949
235 Ga0207681_10237421
236 Ga0207659_10297519
237 Ga0207706_10071382
238 Ga0207709_10157374
239 Ga0207670_10024284
240 Ga0207669_10021928
241 Ga0207691_10182330
242 Ga0207711_10362516
243 Ga0207667_10171753
244 Ga0207651_10008762
245 Ga0207712_10101818
246 Ga0207658_10515568
247 Ga0207677_10024461
248 Ga0207708_10001028
249 Ga0207708_10110104
250 Ga0207648_10032487
251 Ga0207675_100059606
252 Ga0207675_100077987
253 Ga0207675_100160522
254 Ga0209588_1002327
255 Ga0209588_1004500
256 Ga0207428_10036170
257 Ga0207428_10090720
258 Ga0207428_10110871
259 Ga0268265_10004344
260 Ga0268265_10005884
261 Ga0265338_10014203
262 Ga0265338_10062397
263 Ga0307405_10035591
264 Ga0307413_10064551
265 Ga0307416_100242782
266 Ga0451853_2428109
267 Ga0453683_0003251
268 Ga0451576_0037837
269 Ga0451576_0283494
270 Ga0495592_0179024
271 Ga0495653_0052132
272 Ga0495639_0170927
273 Ga0495621_0049905
274 Ga0495656_0331053
275 Ga0495669_0181305
276 Ga0495680_0315861
277 Ga0501034_0031197
278 Ga0501040_0189090
279 Ga0501047_0035938
280 Ga0501072_0003421
281 Ga0501076_0041460
282 Ga0501045_0041004
283 nmdc:mga0yw44_212067_c1
284 nmdc:mga0yw44_99133_c1
285 nmdc:mga0k408_6922_c1
286 nmdc:mga06z11_24826_c1
287 nmdc:mga05p37_21173_c1
288 nmdc:mga05p37_26996_c1
289 nmdc:mga05p37_300_c1
290 nmdc:mga05p37_6821_c1
291 nmdc:mga0qj67_129743_c1
292 nmdc:mga08y16_163848_c1
293 nmdc:mga08y16_55683_c1
294 nmdc:mga08y16_77193_c1
295 nmdc:mga0n895_336723_c1
296 nmdc:mga0n895_3_c1
297 nmdc:mga0n895_89102_c1
298 nmdc:mga0rr50_198673_c1
299 nmdc:mga0rr50_39_c1
300 nmdc:mga08x19_243801_c1
301 nmdc:mga08x19_48865_c1
302 nmdc:mga08x19_73_c1
303 nmdc:mga0a205_2746_c1
304 nmdc:mga0a205_433169_c1
305 Ga0501084_0476478
306 Ga0590071_000103
307 Ga0590071_000188
308 Ga0590071_028246
309 Ga0590074_000108
310 Ga0590074_000142
311 Ga0590075_000120
312 Ga0590075_000594
313 Ga0590075_014032
314 Ga0590077_000230
315 Ga0590077_000445
316 Ga0590077_004909
317 Ga0590077_025639
318 Ga0530510_0016632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

26

137

0.94

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

178

306

0.93

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

210

340

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eih-assembly1.cif.gz_A crystal structure of nad-dependent alcohol dehydrogenase 0.9647 1 342
2eih-assembly1.cif.gz_A crystal structure of nad-dependent alcohol dehydrogenase 0.9619 1 342
6n7l-assembly3.cif.gz_K crystal structure of an alcohol dehydrogenase from elizabethkingia anophelis nuhp1 0.9449 1 341
4jbh-assembly2.cif.gz_D-2 2.2a resolution structure of cobalt and zinc bound thermostable alcohol dehydrogenase from pyrobaculum aerophilum 0.9439 1 342
4jbg-assembly1.cif.gz_A 1.75a resolution structure of a thermostable alcohol dehydrogenase from pyrobaculum aerophilum 0.9419 1 342
ID Description Score Start End Superfamily
2eihB01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9691 1 342 3.90.180.10
af_A0A286Y901_130_273_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9665 147 289 3.40.50.720
af_O65423_126_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9645 153 289 3.40.50.720
2eihB01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9597 1 342 3.90.180.10
af_Q3UNZ8_155_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.959 159 285 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q7WCR8-F1-model_v4 deleted 0.9719 1 341
AF-A0A268IDG5-F1-model_v4 deleted 0.9708 1 342
AF-A0A1F7L732-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9696 1 342 GO:0016491
AF-A0A536CWK0-F1-model_v4 Zinc-binding dehydrogenase 0.9694 1 342 GO:0016491
AF-A0A2E1WXA7-F1-model_v4 Alcohol dehydrogenase 0.9685 110 342 GO:0016491

Map