F231566

General Info

Members Datasets Scaffolds Average Seq Length
159 94 318 205

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10058928|Ga0070681_100589282
Length 220
Sequence MDDFVRFGSRDFCLMILLLAFARGMDFLSTWVATPNLVLEGNPIAKKLGWRWGAVVNIAISVGMAFWPATAIAVSTMSVLVASRNFQSAWLMRTMGEDRYREWHIARIRETRIVLYLICLAGNTLLVAAVGVAIVFYAGNSVPASGLIAAVAPLSIGMGIVGYALAVAFYTMLAVWRMRRPWRRKSQALPAGPAILVNSAALKAPLADSCACETGEIPGK

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
47 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
48 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
49 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
50 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
51 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
52 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
53 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
56 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
59 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
64 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
65 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
66 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
67 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
68 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
69 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
79 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
80 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
81 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
82 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
83 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
88 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
89 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
90 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
91 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
92 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.74
Stem 0
Stem Tuber 0
Unclassified 20.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10058928 3300005458 Bacteria 3819
2 rootH2_10218865 3300003320 Bacteria 1356
3 rootH1_10225350 3300003323 Unclassified 2210
4 Ga0068869_100412366 3300005334 Bacteria 1113
5 Ga0068868_100686214 3300005338 Bacteria 915
6 Ga0070689_100037556 3300005340 Bacteria 3703
7 Ga0070675_100527194 3300005354 Unclassified 1066
8 Ga0070688_100039213 3300005365 Bacteria 2898
9 Ga0070688_100403653 3300005365 Bacteria 1012
10 Ga0070688_100415802 3300005365 Unclassified 998
11 Ga0070688_100557364 3300005365 Bacteria 872
12 Ga0070714_100026991 3300005435 Bacteria 4751
13 Ga0070713_100550712 3300005436 Bacteria 1092
14 Ga0070713_100759001 3300005436 Unclassified 928
15 Ga0070711_100007295 3300005439 Bacteria 6723
16 Ga0070679_100320278 3300005530 Bacteria 1500
17 Ga0070679_100458086 3300005530 Unclassified 1220
18 Ga0070679_100842247 3300005530 Unclassified 860
19 Ga0068853_100201438 3300005539 Viruses 1812
20 Ga0070686_100783358 3300005544 Unclassified 767
21 Ga0070695_100840326 3300005545 Bacteria 738
22 Ga0068855_100030799 3300005563 Bacteria 6414
23 Ga0068856_100471259 3300005614 Bacteria 1276
24 Ga0068856_100626834 3300005614 Unclassified 1096
25 Ga0070702_100089178 3300005615 Bacteria 1866
26 Ga0068864_100353771 3300005618 Bacteria 1386
27 Ga0068864_100456126 3300005618 Bacteria 1223
28 Ga0070717_10960200 3300006028 Bacteria 778
29 Ga0070712_100291658 3300006175 Unclassified 1317
30 Ga0070712_100432974 3300006175 Unclassified 1092
31 Ga0097621_100067078 3300006237 Bacteria 2957
32 Ga0068871_100870824 3300006358 Bacteria 834
33 Ga0075433_10546638 3300006852 Bacteria 1018
34 Ga0097620_100502657 3300006931 Unclassified 1307
35 Ga0099794_10124207 3300007265 Bacteria 1300
36 Ga0105240_10031649 3300009093 Bacteria 6855
37 Ga0105240_10133371 3300009093 Bacteria 2976
38 Ga0105240_10138231 3300009093 Bacteria 2915
39 Ga0105240_10198586 3300009093 Bacteria 2352
40 Ga0105248_10199476 3300009177 Unclassified 2254
41 Ga0105238_10055344 3300009551 Bacteria 3982
42 Ga0157370_10087779 3300013104 Bacteria 2921
43 Ga0157370_10172230 3300013104 Bacteria 2012
44 Ga0157372_10371974 3300013307 Eukaryota 1665
45 Ga0157372_11178283 3300013307 Bacteria 886
46 Ga0163163_10000014 3300014325 Bacteria 231615
47 Ga0163163_10259706 3300014325 Bacteria 1788
48 Ga0163163_11737634 3300014325 Unclassified 684
49 Ga0157376_11237319 3300014969 Unclassified 775
50 Ga0224712_10191715 3300022467 Bacteria 925
51 Ga0207707_10047964 3300025912 Bacteria 3721
52 Ga0207707_10430579 3300025912 Unclassified 1130
53 Ga0207695_10073373 3300025913 Bacteria 3487
54 Ga0207695_10082003 3300025913 Bacteria 3262
55 Ga0207695_10149486 3300025913 Bacteria 2276
56 Ga0207695_10180143 3300025913 Bacteria 2034
57 Ga0207663_10005210 3300025916 Bacteria 6542
58 Ga0207663_10347749 3300025916 Bacteria 1122
59 Ga0207652_10336912 3300025921 Bacteria 1362
60 Ga0207652_10567533 3300025921 Bacteria 1019
61 Ga0207694_10006799 3300025924 Bacteria 8681
62 Ga0207670_10043507 3300025936 Bacteria 2966
63 Ga0207689_10659699 3300025942 Unclassified 881
64 Ga0207667_10029049 3300025949 Bacteria 6000
65 Ga0207702_10204802 3300026078 Unclassified 1831
66 Ga0207641_10139183 3300026088 Bacteria 2188
67 Ga0207676_10428020 3300026095 Bacteria 1243
68 Ga0207676_10449209 3300026095 Bacteria 1215
69 Ga0265337_1000251 3300028556 Bacteria 29120
70 Ga0265337_1001114 3300028556 Bacteria 13754
71 Ga0265337_1004556 3300028556 Bacteria 5720
72 Ga0265337_1008135 3300028556 Bacteria 3844
73 Ga0265337_1019160 3300028556 Bacteria 2162
74 Ga0265337_1019651 3300028556 Bacteria 2126
75 Ga0265337_1030575 3300028556 Bacteria 1603
76 Ga0265337_1041190 3300028556 Bacteria 1329
77 Ga0265326_10029425 3300028558 Bacteria 1565
78 Ga0265319_1000003 3300028563 Bacteria 340561
79 Ga0265319_1008439 3300028563 Bacteria 4512
80 Ga0265319_1036372 3300028563 Bacteria 1684
81 Ga0265334_10009625 3300028573 Bacteria 4088
82 Ga0265318_10049141 3300028577 Bacteria 1587
83 Ga0265323_10020141 3300028653 Bacteria 2571
84 Ga0265322_10024406 3300028654 Bacteria 1729
85 Ga0265322_10059129 3300028654 Unclassified 1087
86 Ga0265336_10005052 3300028666 Bacteria 4911
87 Ga0265336_10019411 3300028666 Bacteria 2193
88 Ga0265338_10000263 3300028800 Bacteria 95638
89 Ga0265338_10000513 3300028800 Bacteria 68145
90 Ga0265338_10008532 3300028800 Bacteria 12412
91 Ga0265338_10009147 3300028800 Bacteria 11889
92 Ga0265338_10015850 3300028800 Bacteria 8250
93 Ga0265338_10017194 3300028800 Bacteria 7812
94 Ga0265338_10017259 3300028800 Bacteria 7792
95 Ga0265338_10022493 3300028800 Bacteria 6524
96 Ga0265338_10035090 3300028800 Bacteria 4829
97 Ga0265338_10098799 3300028800 Bacteria 2386
98 Ga0265338_10108901 3300028800 Bacteria 2236
99 Ga0265338_10443012 3300028800 Bacteria 920
100 Ga0265324_10021950 3300029957 Bacteria 2287
101 Ga0265328_10045764 3300031239 Bacteria 1609
102 Ga0265320_10000259 3300031240 Bacteria 43696
103 Ga0265320_10000389 3300031240 Bacteria 35533
104 Ga0265320_10005686 3300031240 Bacteria 7956
105 Ga0265320_10007591 3300031240 Bacteria 6721
106 Ga0265320_10007885 3300031240 Bacteria 6569
107 Ga0265320_10073260 3300031240 Bacteria 1610
108 Ga0265320_10074770 3300031240 Bacteria 1590
109 Ga0265320_10118938 3300031240 Bacteria 1206
110 Ga0265320_10150238 3300031240 Unclassified 1052
111 Ga0265329_10153755 3300031242 Bacteria 746
112 Ga0265340_10000287 3300031247 Bacteria 26530
113 Ga0265340_10013745 3300031247 Bacteria 4246
114 Ga0265340_10132235 3300031247 Bacteria 1144
115 Ga0265316_10001121 3300031344 Bacteria 29042
116 Ga0265316_10089150 3300031344 Bacteria 2354
117 Ga0265316_10185295 3300031344 Bacteria 1548
118 Ga0265313_10030412 3300031595 Bacteria 2780
119 Ga0265314_10172358 3300031711 Bacteria 1305
120 Ga0265314_10185977 3300031711 Bacteria 1240
121 Ga0265342_10026462 3300031712 Bacteria 3635
122 Ga0265342_10128925 3300031712 Bacteria 1419
123 Ga0316576_10167923 3300031727 Bacteria 1656
124 Ga0316577_10317662 3300031733 Bacteria 883
125 Ga0316583_10075599 3300032133 Bacteria 1178
126 Ga0373954_0009052 3300035118 Bacteria 4381
127 Ga0373955_0118021 3300035172 Bacteria 1540
128 Ga0373933_0028619 3300035724 Bacteria 3217
129 Ga0373937_0012207 3300036401 Bacteria 7544
130 Ga0373937_0938679 3300036401 Unclassified 814
131 Ga0373925_0376726 3300037068 Bacteria 1155
132 Ga0453684_0007891 3300044712 Bacteria 19328
133 Ga0451576_0203051 3300045051 Bacteria 2070
134 Ga0451576_0238116 3300045051 Bacteria 1901
135 Ga0451576_0281229 3300045051 Unclassified 1740
136 Ga0451576_1635574 3300045051 Unclassified 668
137 Ga0466958_0231567 3300045836 Unclassified 1180
138 Ga0495629_0037998 3300046459 Bacteria 3393
139 Ga0495618_0000947 3300046514 Bacteria 19959
140 Ga0495628_0236959 3300046516 Unclassified 1366
141 Ga0495630_0029760 3300046517 Bacteria 4060
142 Ga0495630_0432820 3300046517 Bacteria 1008
143 Ga0495666_0382798 3300046526 Unclassified 633
144 Ga0495652_0298362 3300046529 Bacteria 1173
145 Ga0495640_0248732 3300046533 Unclassified 1114
146 Ga0495586_0000831 3300046535 Bacteria 17728
147 Ga0495587_0276678 3300046536 Unclassified 941
148 Ga0495587_0304596 3300046536 Unclassified 891
149 Ga0495645_0031867 3300046543 Bacteria 3843
150 Ga0495634_0011017 3300046642 Eukaryota 6598
151 Ga0495635_0084576 3300046663 Bacteria 2171
152 Ga0495613_0016258 3300046689 Bacteria 5544
153 Ga0495604_0242109 3300047317 Unclassified 1233
154 Ga0495674_0190428 3300047319 Unclassified 1705
155 Ga0495680_0065922 3300047322 Bacteria 2772
156 Ga0495684_0205834 3300047471 Unclassified 1449
157 Ga0501033_0068734 3300049570 Bacteria 2604
158 Ga0501034_0231062 3300049571 Bacteria 1799
159 Ga0495601_0168746 3300053077 Unclassified 1430
160 Ga0070681_10058928
161 rootH2_10218865
162 rootH1_10225350
163 Ga0068869_100412366
164 Ga0068868_100686214
165 Ga0070689_100037556
166 Ga0070675_100527194
167 Ga0070688_100039213
168 Ga0070688_100403653
169 Ga0070688_100415802
170 Ga0070688_100557364
171 Ga0070714_100026991
172 Ga0070713_100550712
173 Ga0070713_100759001
174 Ga0070711_100007295
175 Ga0070679_100320278
176 Ga0070679_100458086
177 Ga0070679_100842247
178 Ga0068853_100201438
179 Ga0070686_100783358
180 Ga0070695_100840326
181 Ga0068855_100030799
182 Ga0068856_100471259
183 Ga0068856_100626834
184 Ga0070702_100089178
185 Ga0068864_100353771
186 Ga0068864_100456126
187 Ga0070717_10960200
188 Ga0070712_100291658
189 Ga0070712_100432974
190 Ga0097621_100067078
191 Ga0068871_100870824
192 Ga0075433_10546638
193 Ga0097620_100502657
194 Ga0099794_10124207
195 Ga0105240_10031649
196 Ga0105240_10133371
197 Ga0105240_10138231
198 Ga0105240_10198586
199 Ga0105248_10199476
200 Ga0105238_10055344
201 Ga0157370_10087779
202 Ga0157370_10172230
203 Ga0157372_10371974
204 Ga0157372_11178283
205 Ga0163163_10000014
206 Ga0163163_10259706
207 Ga0163163_11737634
208 Ga0157376_11237319
209 Ga0224712_10191715
210 Ga0207707_10047964
211 Ga0207707_10430579
212 Ga0207695_10073373
213 Ga0207695_10082003
214 Ga0207695_10149486
215 Ga0207695_10180143
216 Ga0207663_10005210
217 Ga0207663_10347749
218 Ga0207652_10336912
219 Ga0207652_10567533
220 Ga0207694_10006799
221 Ga0207670_10043507
222 Ga0207689_10659699
223 Ga0207667_10029049
224 Ga0207702_10204802
225 Ga0207641_10139183
226 Ga0207676_10428020
227 Ga0207676_10449209
228 Ga0265337_1000251
229 Ga0265337_1001114
230 Ga0265337_1004556
231 Ga0265337_1008135
232 Ga0265337_1019160
233 Ga0265337_1019651
234 Ga0265337_1030575
235 Ga0265337_1041190
236 Ga0265326_10029425
237 Ga0265319_1000003
238 Ga0265319_1008439
239 Ga0265319_1036372
240 Ga0265334_10009625
241 Ga0265318_10049141
242 Ga0265323_10020141
243 Ga0265322_10024406
244 Ga0265322_10059129
245 Ga0265336_10005052
246 Ga0265336_10019411
247 Ga0265338_10000263
248 Ga0265338_10000513
249 Ga0265338_10008532
250 Ga0265338_10009147
251 Ga0265338_10015850
252 Ga0265338_10017194
253 Ga0265338_10017259
254 Ga0265338_10022493
255 Ga0265338_10035090
256 Ga0265338_10098799
257 Ga0265338_10108901
258 Ga0265338_10443012
259 Ga0265324_10021950
260 Ga0265328_10045764
261 Ga0265320_10000259
262 Ga0265320_10000389
263 Ga0265320_10005686
264 Ga0265320_10007591
265 Ga0265320_10007885
266 Ga0265320_10073260
267 Ga0265320_10074770
268 Ga0265320_10118938
269 Ga0265320_10150238
270 Ga0265329_10153755
271 Ga0265340_10000287
272 Ga0265340_10013745
273 Ga0265340_10132235
274 Ga0265316_10001121
275 Ga0265316_10089150
276 Ga0265316_10185295
277 Ga0265313_10030412
278 Ga0265314_10172358
279 Ga0265314_10185977
280 Ga0265342_10026462
281 Ga0265342_10128925
282 Ga0316576_10167923
283 Ga0316577_10317662
284 Ga0316583_10075599
285 Ga0373954_0009052
286 Ga0373955_0118021
287 Ga0373933_0028619
288 Ga0373937_0012207
289 Ga0373937_0938679
290 Ga0373925_0376726
291 Ga0453684_0007891
292 Ga0451576_0203051
293 Ga0451576_0238116
294 Ga0451576_0281229
295 Ga0451576_1635574
296 Ga0466958_0231567
297 Ga0495629_0037998
298 Ga0495618_0000947
299 Ga0495628_0236959
300 Ga0495630_0029760
301 Ga0495630_0432820
302 Ga0495666_0382798
303 Ga0495652_0298362
304 Ga0495640_0248732
305 Ga0495586_0000831
306 Ga0495587_0276678
307 Ga0495587_0304596
308 Ga0495645_0031867
309 Ga0495634_0011017
310 Ga0495635_0084576
311 Ga0495613_0016258
312 Ga0495604_0242109
313 Ga0495674_0190428
314 Ga0495680_0065922
315 Ga0495684_0205834
316 Ga0501033_0068734
317 Ga0501034_0231062
318 Ga0495601_0168746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7na7-assembly1.cif.gz_R structures of human ghrelin receptor-gi complexes with ghrelin and a synthetic agonist 0.7067 11 76
4hkr-assembly1.cif.gz_A calcium release-activated calcium (crac) channel orai 0.4802 13 159
4hks-assembly1.cif.gz_A calcium release-activated calcium (crac) channel orai, k163w mutant 0.4796 13 159
4hkr-assembly1.cif.gz_A calcium release-activated calcium (crac) channel orai 0.4424 13 159
4hks-assembly1.cif.gz_A calcium release-activated calcium (crac) channel orai, k163w mutant 0.4416 13 159
ID Description Score Start End Superfamily
af_F1QF39_8_348_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6085 11 76 1.20.1070.10
4hksA00 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Calcium release-activated calcium channel protein Orai 0.4796 13 159 1.20.140.140
af_Q58046_10_211_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.4724 6 96 1.20.58.220
4hksA00 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Calcium release-activated calcium channel protein Orai 0.4416 13 159 1.20.140.140
1hs7A00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4341 5 89 1.20.58.70
ID Description Score Start End GO Terms
AF-A0A7C3HMF7-F1-model_v4 DUF5658 domain-containing protein 0.6913 1 131 GO:0016020
AF-A0A850LX12-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.6757 5 117 GO:0016020
AF-A0A7V3QGE2-F1-model_v4 DUF4013 domain-containing protein 0.6715 1 136 GO:0016020
AF-A0A2E5EJ58-F1-model_v4 DUF5658 domain-containing protein 0.6674 2 136 GO:0016020
AF-A0A524CEG8-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.6627 6 118 GO:0016020

Map