F230752

General Info

Members Datasets Scaffolds Average Seq Length
158 114 158 133

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_219536_c1|nmdc:mga05p37_219536_c1_269_754
Length 161
Sequence VVGAAGRRYAEEGLSTDLGIAPQFDGGENMNPVVHFEMPYENRERMAKFYKSAFGWQTQMLGEDMGNYVLATTTESGADGPKRPGAINGGFFPKKPDWPAQHPSVVIAVDDVKAAAKSVRDAGGNVLGEPIEIPGVGKYVSFTDTEGNRVSMLQPTHGHKA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
79 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
85 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
88 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
89 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
90 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
91 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
92 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
96 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
97 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
98 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
99 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
100 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
101 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
106 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
107 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
110 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
111 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
112 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
113 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
114 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.49
Nodule 0
Rhizoplane 1.27
Rhizosphere 87.97
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10016668 3300003203 Bacteria 3058
2 rootL2_10156244 3300003322 Bacteria 1568
3 Ga0070658_10020342 3300005327 Bacteria 5318
4 Ga0070680_100051985 3300005336 Bacteria 3345
5 Ga0070682_100236760 3300005337 Bacteria 1308
6 Ga0068868_100216524 3300005338 Bacteria 1602
7 Ga0070661_101720808 3300005344 Unclassified 531
8 Ga0070668_101079241 3300005347 Bacteria 724
9 Ga0070671_100085016 3300005355 Bacteria 2646
10 Ga0070659_100110189 3300005366 Bacteria 2222
11 Ga0070710_10783760 3300005437 Unclassified 680
12 Ga0070694_101933348 3300005444 Bacteria 504
13 Ga0070708_100049342 3300005445 Bacteria 3723
14 Ga0070681_10099898 3300005458 Bacteria 2848
15 Ga0068867_100261935 3300005459 Bacteria 1410
16 Ga0070679_100092928 3300005530 Unclassified 3004
17 Ga0070695_101257111 3300005545 Unclassified 610
18 Ga0070696_100463151 3300005546 Unclassified 1002
19 Ga0070665_100491861 3300005548 Bacteria 1238
20 Ga0068855_100184477 3300005563 Bacteria 2357
21 Ga0070664_100107343 3300005564 Bacteria 2434
22 Ga0068856_100117109 3300005614 Bacteria 2665
23 Ga0068856_100170574 3300005614 Bacteria 2188
24 Ga0068856_100485844 3300005614 Bacteria 1256
25 Ga0068859_100106513 3300005617 Bacteria 2863
26 Ga0068861_102051747 3300005719 Unclassified 571
27 Ga0068870_10772715 3300005840 Unclassified 669
28 Ga0068860_101753953 3300005843 Unclassified 643
29 Ga0081539_10000044 3300005985 Bacteria 284021
30 Ga0075432_10086814 3300006058 Bacteria 1141
31 Ga0070715_10194923 3300006163 Bacteria 1025
32 Ga0075362_10039296 3300006177 Bacteria 2080
33 Ga0075369_10000077 3300006186 Bacteria 25424
34 Ga0075366_10000001 3300006195 Bacteria 569172
35 Ga0075370_10001763 3300006353 Bacteria 9653
36 Ga0075370_10107870 3300006353 Bacteria 1615
37 Ga0068871_101149063 3300006358 Bacteria 727
38 Ga0075428_100191294 3300006844 Bacteria 2213
39 Ga0075428_100195332 3300006844 Bacteria 2188
40 Ga0075428_102343884 3300006844 Bacteria 549
41 Ga0075430_100230571 3300006846 Bacteria 1535
42 Ga0075431_100159516 3300006847 Archaea 2320
43 Ga0075431_100281187 3300006847 Bacteria 1685
44 Ga0075433_10095007 3300006852 Bacteria 2638
45 Ga0075433_10226456 3300006852 Bacteria 1661
46 Ga0075433_11349250 3300006852 Unclassified 617
47 Ga0075434_100086782 3300006871 Unclassified 3129
48 Ga0075434_100396304 3300006871 Unclassified 1401
49 Ga0075429_100202376 3300006880 Archaea 1740
50 Ga0075429_100497663 3300006880 Unclassified 1068
51 Ga0075436_100032105 3300006914 Bacteria 3618
52 Ga0097620_100106515 3300006931 Bacteria 2863
53 Ga0075435_100145745 3300007076 Unclassified 1989
54 Ga0075435_100220528 3300007076 Bacteria 1610
55 Ga0105245_10526257 3300009098 Unclassified 1201
56 Ga0114129_10000853 3300009147 Bacteria 39495
57 Ga0114129_10010715 3300009147 Bacteria 13069
58 Ga0114129_10034373 3300009147 Bacteria 7159
59 Ga0114129_10112667 3300009147 Archaea 3752
60 Ga0114129_10141435 3300009147 Bacteria 3298
61 Ga0114129_10820345 3300009147 Unclassified 1185
62 Ga0114129_12113517 3300009147 Unclassified 679
63 Ga0105242_10914201 3300009176 Bacteria 879
64 Ga0105248_10066735 3300009177 Bacteria 4039
65 Ga0105237_10973664 3300009545 Unclassified 855
66 Ga0105249_10142847 3300009553 Unclassified 2297
67 Ga0157371_10101661 3300013102 Bacteria 2039
68 Ga0157369_11097358 3300013105 Bacteria 813
69 Ga0157378_10235497 3300013297 Unclassified 1747
70 Ga0157378_10363305 3300013297 Unclassified 1417
71 Ga0163161_10995852 3300017792 Bacteria 715
72 Ga0209026_1003506 3300025250 Bacteria 5105
73 Ga0207685_10286291 3300025905 Bacteria 810
74 Ga0207643_10550784 3300025908 Unclassified 740
75 Ga0207705_10001327 3300025909 Bacteria 19799
76 Ga0207705_10008641 3300025909 Bacteria 7422
77 Ga0207657_10899563 3300025919 Bacteria 682
78 Ga0207649_10115089 3300025920 Bacteria 1803
79 Ga0207652_10002200 3300025921 Bacteria 16631
80 Ga0207652_10039252 3300025921 Bacteria 4018
81 Ga0207687_11805277 3300025927 Unclassified 523
82 Ga0207644_10072008 3300025931 Bacteria 2530
83 Ga0207690_10505602 3300025932 Bacteria 978
84 Ga0207668_11185598 3300025972 Bacteria 686
85 Ga0207702_10213007 3300026078 Bacteria 1797
86 Ga0207702_10613861 3300026078 Bacteria 1068
87 Ga0207674_11472266 3300026116 Bacteria 650
88 Ga0207675_101644476 3300026118 Unclassified 662
89 Ga0207428_10555365 3300027907 Bacteria 830
90 Ga0268266_10384315 3300028379 Bacteria 1325
91 Ga0316578_10914691 3300031728 Bacteria 506
92 Ga0307410_10175055 3300031852 Archaea 1620
93 Ga0307406_10427046 3300031901 Archaea 1057
94 Ga0307412_11073792 3300031911 Archaea 715
95 Ga0307415_100827200 3300032126 Unclassified 848
96 Ga0395899_0000088 3300037312 Bacteria 156987
97 Ga0395899_0241403 3300037312 Bacteria 1243
98 Ga0395900_0031470 3300037418 Bacteria 5452
99 Ga0395900_0125190 3300037418 Bacteria 2636
100 Ga0395905_0066767 3300037471 Bacteria 3369
101 Ga0395905_0167707 3300037471 Bacteria 2063
102 Ga0451791_1743126 3300041451 Unclassified 831
103 Ga0439433_0156962 3300041999 Bacteria 588
104 Ga0451577_0000197 3300042876 Bacteria 126180
105 Ga0451577_0231493 3300042876 Bacteria 1671
106 Ga0453683_0000169 3300044673 Bacteria 90993
107 Ga0453683_0202191 3300044673 Bacteria 1261
108 Ga0453684_0000393 3300044712 Bacteria 179711
109 Ga0453684_0001222 3300044712 Bacteria 78832
110 Ga0451576_0000145 3300045051 Bacteria 179711
111 Ga0451576_0000266 3300045051 Bacteria 127813
112 Ga0495641_0173360 3300046461 Bacteria 965
113 Ga0495622_0000035 3300046557 Bacteria 122963
114 Ga0495634_0227515 3300046642 Bacteria 1149
115 Ga0495659_0074762 3300046664 Unclassified 1275
116 Ga0495658_0003247 3300046683 Bacteria 8088
117 Ga0495658_0695626 3300046683 Unclassified 651
118 Ga0495649_0000073 3300046694 Bacteria 86337
119 Ga0495600_0327601 3300046809 Bacteria 962
120 Ga0495602_0295332 3300048088 Bacteria 1188
121 Ga0496112_0586877 3300048915 Bacteria 1047
122 Ga0501033_0200089 3300049570 Bacteria 1427
123 Ga0501038_0038953 3300049574 Bacteria 4160
124 Ga0501209_062328 3300049656 Archaea 1044
125 Ga0501275_054976 3300049772 Archaea 593
126 nmdc:mga03683_14098_c1 3300050489 Bacteria 2953
127 nmdc:mga03683_96584_c1 3300050489 Bacteria 1294
128 nmdc:mga00v17_5907_c1 3300050491 Unclassified 1624
129 nmdc:mga0yw44_8417_c1 3300050492 Bacteria 5139
130 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
131 nmdc:mga07m45_115201_c1 3300050496 Bacteria 1550
132 nmdc:mga05p37_1301028_c1 3300050507 Bacteria 741
133 nmdc:mga05p37_16877_c1 3300050507 Bacteria 8803
134 nmdc:mga05p37_219536_c1 3300050507 Bacteria 2295
135 nmdc:mga05p37_238806_c1 3300050507 Bacteria 2186
136 nmdc:mga05p37_254975_c1 3300050507 Bacteria 2103
137 nmdc:mga05p37_258925_c1 3300050507 Unclassified 2083
138 nmdc:mga05p37_796506_c1 3300050507 Archaea 1035
139 nmdc:mga09592_1001270_c1 3300050508 Unclassified 698
140 nmdc:mga09592_123907_c1 3300050508 Archaea 2221
141 nmdc:mga09592_273525_c1 3300050508 Bacteria 1465
142 nmdc:mga06r32_570853_c1 3300050510 Archaea 1104
143 nmdc:mga06r32_99273_c1 3300050510 Bacteria 2855
144 nmdc:mga0n895_106249_c1 3300050512 Unclassified 2820
145 nmdc:mga0n895_272161_c2 3300050512 Unclassified 850
146 nmdc:mga0n895_793_c1 3300050512 Bacteria 22553
147 nmdc:mga0rr50_1367771_c1 3300050513 Unclassified 600
148 nmdc:mga0rr50_7551_c1 3300050513 Bacteria 6715
149 nmdc:mga08x19_58706_c1 3300050514 Bacteria 2490
150 nmdc:mga0a205_102730_c1 3300050515 Bacteria 2757
151 nmdc:mga0a205_1149842_c1 3300050515 Unclassified 624
152 nmdc:mga0a205_11648_c2 3300050515 Bacteria 7631
153 nmdc:mga0sz30_8_c2 3300050516 Bacteria 48225
154 Ga0495619_0396358 3300053085 Unclassified 953
155 Ga0500566_0000001 3300053094 Bacteria 1101031
156 Ga0500614_110707 3300053123 Bacteria 800
157 Ga0500559_0081044 3300053136 Bacteria 1475
158 Ga0587130_037907 3300059631 Bacteria 574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005719 Ga0068861_102051747 Ga0068861_1020517471 128
2 3300005840 Ga0068870_10772715 Ga0068870_107727152 128
3 3300006163 Ga0070715_10194923 Ga0070715_101949232 128
4 3300009176 Ga0105242_10914201 Ga0105242_109142012 128
5 3300025905 Ga0207685_10286291 Ga0207685_102862912 128
6 3300025908 Ga0207643_10550784 Ga0207643_105507842 128
7 3300026118 Ga0207675_101644476 Ga0207675_1016444762 128
8 3300037312 Ga0395899_0000088 Ga0395899_0000088_76928_77323 128
9 3300037418 Ga0395900_0125190 Ga0395900_0125190_164_559 128
10 3300046683 Ga0495658_0695626 Ga0495658_0695626_194_589 128
11 3300005327 Ga0070658_10020342 Ga0070658_100203423 129
12 3300006844 Ga0075428_102343884 Ga0075428_1023438841 129
13 3300006852 Ga0075433_11349250 Ga0075433_113492501 129
14 3300013105 Ga0157369_11097358 Ga0157369_110973582 129
15 3300013297 Ga0157378_10363305 Ga0157378_103633052 129
16 3300025909 Ga0207705_10008641 Ga0207705_100086418 129
17 3300031728 Ga0316578_10914691 Ga0316578_109146911 129
18 3300050515 nmdc:mga0a205_1149842_c1 nmdc:mga0a205_1149842_c1_36_428 129
19 3300005546 Ga0070696_100463151 Ga0070696_1004631512 130
20 3300005843 Ga0068860_101753953 Ga0068860_1017539532 130
21 3300006353 Ga0075370_10001763 Ga0075370_1000176313 130
22 3300006353 Ga0075370_10107870 Ga0075370_101078702 130
23 3300013297 Ga0157378_10235497 Ga0157378_102354972 130
24 3300025250 Ga0209026_1003506 Ga0209026_10035064 130
25 3300025921 Ga0207652_10039252 Ga0207652_100392525 130
26 3300037471 Ga0395905_0167707 Ga0395905_0167707_872_1264 130
27 3300041451 Ga0451791_1743126 Ga0451791_1743126_319_711 130
28 3300042876 Ga0451577_0000197 Ga0451577_0000197_66334_66738 130
29 3300042876 Ga0451577_0231493 Ga0451577_0231493_1166_1561 130
30 3300044673 Ga0453683_0000169 Ga0453683_0000169_52425_52829 130
31 3300044673 Ga0453683_0202191 Ga0453683_0202191_592_987 130
32 3300044712 Ga0453684_0000393 Ga0453684_0000393_59443_59847 130
33 3300044712 Ga0453684_0001222 Ga0453684_0001222_31964_32359 130
34 3300045051 Ga0451576_0000145 Ga0451576_0000145_59443_59847 130
35 3300045051 Ga0451576_0000266 Ga0451576_0000266_90100_90495 130
36 3300046461 Ga0495641_0173360 Ga0495641_0173360_358_759 130
37 3300046557 Ga0495622_0000035 Ga0495622_0000035_22864_23265 130
38 3300046642 Ga0495634_0227515 Ga0495634_0227515_588_989 130
39 3300046683 Ga0495658_0003247 Ga0495658_0003247_471_872 130
40 3300046694 Ga0495649_0000073 Ga0495649_0000073_6679_7080 130
41 3300046809 Ga0495600_0327601 Ga0495600_0327601_92_493 130
42 3300048088 Ga0495602_0295332 Ga0495602_0295332_160_561 130
43 3300049570 Ga0501033_0200089 Ga0501033_0200089_110_502 130
44 3300049574 Ga0501038_0038953 Ga0501038_0038953_1552_1944 130
45 3300050489 nmdc:mga03683_96584_c1 nmdc:mga03683_96584_c1_53_445 130
46 3300050492 nmdc:mga0yw44_8417_c1 nmdc:mga0yw44_8417_c1_875_1267 130
47 3300050496 nmdc:mga07m45_115201_c1 nmdc:mga07m45_115201_c1_684_1076 130
48 3300053094 Ga0500566_0000001 Ga0500566_0000001_669183_669584 130
49 3300053123 Ga0500614_110707 Ga0500614_110707_60_461 130
50 3300053136 Ga0500559_0081044 Ga0500559_0081044_127_528 130
51 3300005355 Ga0070671_100085016 Ga0070671_1000850163 131
52 3300005459 Ga0068867_100261935 Ga0068867_1002619352 131
53 3300005617 Ga0068859_100106513 Ga0068859_1001065133 131
54 3300006358 Ga0068871_101149063 Ga0068871_1011490631 131
55 3300006931 Ga0097620_100106515 Ga0097620_1001065153 131
56 3300009177 Ga0105248_10066735 Ga0105248_100667354 131
57 3300013102 Ga0157371_10101661 Ga0157371_101016613 131
58 3300017792 Ga0163161_10995852 Ga0163161_109958521 131
59 3300025931 Ga0207644_10072008 Ga0207644_100720083 131
60 3300053085 Ga0495619_0396358 Ga0495619_0396358_483_878 131
61 3300003203 JGI25406J46586_10016668 JGI25406J46586_100166683 132
62 3300003322 rootL2_10156244 rootL2_101562443 132
63 3300005336 Ga0070680_100051985 Ga0070680_1000519854 132
64 3300005337 Ga0070682_100236760 Ga0070682_1002367601 132
65 3300005338 Ga0068868_100216524 Ga0068868_1002165242 132
66 3300005344 Ga0070661_101720808 Ga0070661_1017208081 132
67 3300005347 Ga0070668_101079241 Ga0070668_1010792411 132
68 3300005366 Ga0070659_100110189 Ga0070659_1001101892 132
69 3300005437 Ga0070710_10783760 Ga0070710_107837601 132
70 3300005444 Ga0070694_101933348 Ga0070694_1019333481 132
71 3300005445 Ga0070708_100049342 Ga0070708_1000493422 132
72 3300005458 Ga0070681_10099898 Ga0070681_100998984 132
73 3300005530 Ga0070679_100092928 Ga0070679_1000929283 132
74 3300005545 Ga0070695_101257111 Ga0070695_1012571111 132
75 3300005548 Ga0070665_100491861 Ga0070665_1004918611 132
76 3300005563 Ga0068855_100184477 Ga0068855_1001844772 132
77 3300005564 Ga0070664_100107343 Ga0070664_1001073432 132
78 3300005614 Ga0068856_100117109 Ga0068856_1001171092 132
79 3300005614 Ga0068856_100170574 Ga0068856_1001705743 132
80 3300005614 Ga0068856_100485844 Ga0068856_1004858441 132
81 3300005985 Ga0081539_10000044 Ga0081539_10000044104 132
82 3300006058 Ga0075432_10086814 Ga0075432_100868143 132
83 3300006177 Ga0075362_10039296 Ga0075362_100392962 132
84 3300006186 Ga0075369_10000077 Ga0075369_1000007710 132
85 3300006195 Ga0075366_10000001 Ga0075366_10000001390 132
86 3300006844 Ga0075428_100191294 Ga0075428_1001912944 132
87 3300006844 Ga0075428_100195332 Ga0075428_1001953321 132
88 3300006846 Ga0075430_100230571 Ga0075430_1002305712 132
89 3300006847 Ga0075431_100159516 Ga0075431_1001595165 132
90 3300006847 Ga0075431_100281187 Ga0075431_1002811872 132
91 3300006852 Ga0075433_10095007 Ga0075433_100950073 132
92 3300006852 Ga0075433_10226456 Ga0075433_102264562 132
93 3300006871 Ga0075434_100086782 Ga0075434_1000867823 132
94 3300006871 Ga0075434_100396304 Ga0075434_1003963042 132
95 3300006880 Ga0075429_100202376 Ga0075429_1002023762 132
96 3300006880 Ga0075429_100497663 Ga0075429_1004976632 132
97 3300006914 Ga0075436_100032105 Ga0075436_1000321054 132
98 3300007076 Ga0075435_100145745 Ga0075435_1001457452 132
99 3300007076 Ga0075435_100220528 Ga0075435_1002205283 132
100 3300009098 Ga0105245_10526257 Ga0105245_105262572 132
101 3300009147 Ga0114129_10000853 Ga0114129_1000085334 132
102 3300009147 Ga0114129_10010715 Ga0114129_100107154 132
103 3300009147 Ga0114129_10034373 Ga0114129_100343734 132
104 3300009147 Ga0114129_10112667 Ga0114129_101126675 132
105 3300009147 Ga0114129_10141435 Ga0114129_101414352 132
106 3300009147 Ga0114129_10820345 Ga0114129_108203453 132
107 3300009147 Ga0114129_12113517 Ga0114129_121135171 132
108 3300009545 Ga0105237_10973664 Ga0105237_109736642 132
109 3300009553 Ga0105249_10142847 Ga0105249_101428472 132
110 3300025909 Ga0207705_10001327 Ga0207705_1000132714 132
111 3300025919 Ga0207657_10899563 Ga0207657_108995631 132
112 3300025920 Ga0207649_10115089 Ga0207649_101150891 132
113 3300025921 Ga0207652_10002200 Ga0207652_1000220010 132
114 3300025927 Ga0207687_11805277 Ga0207687_118052772 132
115 3300025932 Ga0207690_10505602 Ga0207690_105056022 132
116 3300025972 Ga0207668_11185598 Ga0207668_111855982 132
117 3300026078 Ga0207702_10213007 Ga0207702_102130072 132
118 3300026078 Ga0207702_10613861 Ga0207702_106138611 132
119 3300026116 Ga0207674_11472266 Ga0207674_114722662 132
120 3300027907 Ga0207428_10555365 Ga0207428_105553652 132
121 3300028379 Ga0268266_10384315 Ga0268266_103843151 132
122 3300031852 Ga0307410_10175055 Ga0307410_101750553 132
123 3300031901 Ga0307406_10427046 Ga0307406_104270461 132
124 3300031911 Ga0307412_11073792 Ga0307412_110737921 132
125 3300032126 Ga0307415_100827200 Ga0307415_1008272001 132
126 3300037312 Ga0395899_0241403 Ga0395899_0241403_754_1152 132
127 3300037418 Ga0395900_0031470 Ga0395900_0031470_3897_4295 132
128 3300037471 Ga0395905_0066767 Ga0395905_0066767_846_1244 132
129 3300041999 Ga0439433_0156962 Ga0439433_0156962_24_425 132
130 3300046664 Ga0495659_0074762 Ga0495659_0074762_380_793 132
131 3300048915 Ga0496112_0586877 Ga0496112_0586877_439_855 132
132 3300049656 Ga0501209_062328 Ga0501209_062328_140_553 132
133 3300049772 Ga0501275_054976 Ga0501275_054976_101_514 132
134 3300050489 nmdc:mga03683_14098_c1 nmdc:mga03683_14098_c1_726_1136 132
135 3300050491 nmdc:mga00v17_5907_c1 nmdc:mga00v17_5907_c1_1154_1564 132
136 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_730646_731056 132
137 3300050507 nmdc:mga05p37_1301028_c1 nmdc:mga05p37_1301028_c1_198_596 132
138 3300050507 nmdc:mga05p37_16877_c1 nmdc:mga05p37_16877_c1_2631_3029 132
139 3300050507 nmdc:mga05p37_219536_c1 nmdc:mga05p37_219536_c1_269_754 132
140 3300050507 nmdc:mga05p37_238806_c1 nmdc:mga05p37_238806_c1_1532_1957 132
141 3300050507 nmdc:mga05p37_254975_c1 nmdc:mga05p37_254975_c1_1415_1813 132
142 3300050507 nmdc:mga05p37_258925_c1 nmdc:mga05p37_258925_c1_769_1170 132
143 3300050507 nmdc:mga05p37_796506_c1 nmdc:mga05p37_796506_c1_79_492 132
144 3300050508 nmdc:mga09592_1001270_c1 nmdc:mga09592_1001270_c1_232_657 132
145 3300050508 nmdc:mga09592_123907_c1 nmdc:mga09592_123907_c1_1263_1676 132
146 3300050508 nmdc:mga09592_273525_c1 nmdc:mga09592_273525_c1_62_460 132
147 3300050510 nmdc:mga06r32_570853_c1 nmdc:mga06r32_570853_c1_493_906 132
148 3300050510 nmdc:mga06r32_99273_c1 nmdc:mga06r32_99273_c1_1021_1419 132
149 3300050512 nmdc:mga0n895_106249_c1 nmdc:mga0n895_106249_c1_286_708 132
150 3300050512 nmdc:mga0n895_272161_c2 nmdc:mga0n895_272161_c2_20_418 132
151 3300050512 nmdc:mga0n895_793_c1 nmdc:mga0n895_793_c1_21426_21824 132
152 3300050513 nmdc:mga0rr50_1367771_c1 nmdc:mga0rr50_1367771_c1_33_431 132
153 3300050513 nmdc:mga0rr50_7551_c1 nmdc:mga0rr50_7551_c1_5052_5450 132
154 3300050514 nmdc:mga08x19_58706_c1 nmdc:mga08x19_58706_c1_81_479 132
155 3300050515 nmdc:mga0a205_102730_c1 nmdc:mga0a205_102730_c1_81_479 132
156 3300050515 nmdc:mga0a205_11648_c2 nmdc:mga0a205_11648_c2_4769_5167 132
157 3300050516 nmdc:mga0sz30_8_c2 nmdc:mga0sz30_8_c2_10647_11057 132
158 3300059631 Ga0587130_037907 Ga0587130_037907_39_455 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

33

152

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.9137 1 128
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.9066 2 128
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.8996 1 128
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.8477 2 128
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.8217 4 128
ID Description Score Start End Superfamily
2r6uB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9163 3 128 3.10.180.10
2r6uB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.909 3 128 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.881 1 128 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8607 1 128 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8535 75 128 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A7Z2STA2-F1-model_v4 Glyoxalase 0.9786 1 130
AF-A0A7Z2STA2-F1-model_v4 Glyoxalase 0.9713 1 130
AF-A0A539E0G8-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9693 1 132 GO:0051213
AF-A0A536TQT6-F1-model_v4 VOC family protein 0.9649 1 132
AF-A0A843CQU2-F1-model_v4 VOC family protein 0.9623 77 128

Feature Viewer

pLDDT pTM Quality
89.57 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map