F229772

General Info

Members Datasets Scaffolds Average Seq Length
158 95 316 252

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10139739|Ga0213876_101397391
Length 291
Sequence VNKQRRALNITEKNTGSQRALKRPPANRCWKQKGNAGFYANYMIVFITGASSGFGEATAKKFLGEGAKVIGTGRRKDRLDKVRNTLGPAFYPVVFDVGQRNQVEQAISNLPIEVAAVDVLVNNAGGAVGLDPAQQAQLDDWDTMVDSNVKGLMYCTRLLLPGMIDRGRGDIINIGSTAAEWPYPGGNVYGATKAFVHQFSLNLRADLIGTPIRVTDIQPGLVGGTEFSEVRFKGDKRKAEAVYEGAQPLTPEDIADAIHWVVTRPAHVNINTMQMMPVCQAFAAPTVKRKS

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
25 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
26 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
27 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
28 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
38 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
39 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
40 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
41 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
42 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
43 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
44 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
45 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
46 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
47 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
48 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
49 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
50 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
51 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
52 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
53 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
54 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
55 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
56 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
57 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
58 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
59 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
60 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
61 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
67 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
68 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
69 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
70 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
71 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
72 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
73 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
74 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
75 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
76 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
77 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
78 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
79 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
80 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
81 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
82 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
83 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
84 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
90 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
91 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
92 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
93 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
94 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
95 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.2
Metatranscriptomes 0
Isolates 3.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.16
Nodule 1.27
Rhizoplane 3.8
Rhizosphere 48.73
Stem 0
Stem Tuber 0
Unclassified 5.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10139739 3300021384 Bacteria 1288
2 JGI25406J46586_10009644 3300003203 Bacteria 4318
3 rootL2_10003727 3300003322 Bacteria 6771
4 rootL2_10346208 3300003322 Bacteria 1161
5 JGI25160J50197_1000130 3300003354 Bacteria 67851
6 Ga0065165_1000424 3300005262 Bacteria 66582
7 Ga0070660_100150628 3300005339 Bacteria 1870
8 Ga0070661_100043408 3300005344 Unclassified 3284
9 Ga0070659_100038734 3300005366 Bacteria 3718
10 Ga0070714_100024427 3300005435 Bacteria 4977
11 Ga0070714_100167797 3300005435 Bacteria 1990
12 Ga0070663_100092386 3300005455 Bacteria 2244
13 Ga0070681_10218253 3300005458 Bacteria 1823
14 Ga0070665_100309481 3300005548 Bacteria 1583
15 Ga0070665_100357492 3300005548 Bacteria 1466
16 Ga0068855_100048749 3300005563 Unclassified 4998
17 Ga0068856_100095949 3300005614 Bacteria 2954
18 Ga0068856_100132062 3300005614 Bacteria 2502
19 Ga0068856_100612329 3300005614 Bacteria 1110
20 Ga0081455_10062753 3300005937 Bacteria 3121
21 Ga0081539_10000847 3300005985 Bacteria 58528
22 Ga0105251_10046596 3300009011 Bacteria 2086
23 Ga0105239_10005675 3300010375 Bacteria 14585
24 Ga0157373_10423259 3300013100 Unclassified 956
25 Ga0157369_10005640 3300013105 Bacteria 14544
26 Ga0157369_10034274 3300013105 Bacteria 5574
27 Ga0157369_10396398 3300013105 Bacteria 1432
28 Ga0157369_10959113 3300013105 Bacteria 876
29 Ga0157374_10004635 3300013296 Bacteria 11534
30 Ga0157374_10005492 3300013296 Bacteria 10646
31 Ga0157372_10169790 3300013307 Bacteria 2523
32 Ga0163163_10425710 3300014325 Bacteria 1386
33 Ga0213872_10000742 3300021361 Bacteria 24100
34 Ga0213874_10118923 3300021377 Bacteria 896
35 Ga0213876_10019877 3300021384 Bacteria 3548
36 Ga0213875_10000008 3300021388 Bacteria 533344
37 Ga0213875_10000065 3300021388 Bacteria 128682
38 Ga0213875_10001804 3300021388 Bacteria 13355
39 Ga0213875_10004557 3300021388 Bacteria 7567
40 Ga0213875_10016260 3300021388 Bacteria 3610
41 Ga0209564_1007394 3300025295 Bacteria 5683
42 Ga0207426_1000037 3300025302 Bacteria 442735
43 Ga0207707_10200968 3300025912 Bacteria 1738
44 Ga0207657_10325349 3300025919 Bacteria 1215
45 Ga0207664_10177381 3300025929 Bacteria 1828
46 Ga0207667_10040716 3300025949 Unclassified 4947
47 Ga0207639_10151087 3300026041 Unclassified 1945
48 Ga0207678_10175659 3300026067 Bacteria 1829
49 Ga0207702_10020494 3300026078 Bacteria 5474
50 Ga0207702_10075519 3300026078 Bacteria 2911
51 Ga0207702_10111713 3300026078 Bacteria 2431
52 Ga0207702_10447688 3300026078 Bacteria 1252
53 Ga0268266_10016790 3300028379 Bacteria 6258
54 Ga0265334_10000048 3300028573 Bacteria 90958
55 Ga0307516_10017046 3300031730 Bacteria 7585
56 Ga0373935_0016795 3300035692 Bacteria 4430
57 Ga0373947_0203225 3300035725 Bacteria 1297
58 Ga0373925_0024343 3300037068 Bacteria 4421
59 Ga0395900_0047672 3300037418 Bacteria 4413
60 Ga0395905_0000115 3300037471 Bacteria 133996
61 Ga0436364_0047161 3300037853 Bacteria 2049
62 Ga0436364_0059464 3300037853 Bacteria 1293
63 Ga0436364_0075750 3300037853 Bacteria 3616
64 Ga0436364_0281991 3300037853 Bacteria 1795
65 Ga0436364_0371847 3300037853 Bacteria 18230
66 Ga0436364_0454132 3300037853 Bacteria 2663
67 Ga0436364_0478569 3300037853 Unclassified 1083
68 Ga0436364_0551634 3300037853 Bacteria 1587
69 Ga0436364_0654010 3300037853 Bacteria 80215
70 Ga0436364_1013508 3300037853 Bacteria 3417
71 Ga0436364_1166877 3300037853 Unclassified 1502
72 Ga0436364_1221957 3300037853 Bacteria 6912
73 Ga0436364_1415525 3300037853 Bacteria 425173
74 Ga0436364_1547781 3300037853 Bacteria 2855
75 Ga0400484_04669 3300038725 Bacteria 1517
76 Ga0400484_14968 3300038725 Bacteria 2211
77 Ga0400484_27025 3300038725 Bacteria 4342
78 Ga0400490_10246 3300038726 Bacteria 16289
79 Ga0400490_44325 3300038726 Bacteria 34624
80 Ga0400490_51540 3300038726 Bacteria 54933
81 Ga0400490_51725 3300038726 Bacteria 40235
82 Ga0400491_07197 3300038727 Bacteria 3062
83 Ga0400491_11662 3300038727 Bacteria 11169
84 Ga0400485_01173 3300038735 Bacteria 1657
85 Ga0400485_11150 3300038735 Bacteria 8884
86 Ga0400485_15801 3300038735 Bacteria 116572
87 Ga0400488_06519 3300038741 Bacteria 19007
88 Ga0400488_54814 3300038741 Bacteria 8629
89 Ga0400488_60110 3300038741 Bacteria 3165
90 Ga0400486_11939 3300038742 Bacteria 121593
91 Ga0400486_21081 3300038742 Bacteria 8921
92 Ga0400486_22786 3300038742 Bacteria 18415
93 Ga0400486_27586 3300038742 Bacteria 7828
94 Ga0400483_001147 3300039062 Bacteria 14835
95 Ga0400483_048604 3300039062 Bacteria 1656
96 Ga0400483_101337 3300039062 Bacteria 11196
97 Ga0400483_150923 3300039062 Bacteria 21554
98 Ga0400483_166964 3300039062 Bacteria 15997
99 Ga0400483_203035 3300039062 Bacteria 23201
100 Ga0400483_216236 3300039062 Bacteria 1588
101 Ga0400487_27475 3300039110 Bacteria 33769
102 Ga0400487_39402 3300039110 Bacteria 8826
103 Ga0400487_65924 3300039110 Bacteria 46544
104 Ga0436365_0758206 3300039437 Bacteria 922
105 Ga0436365_0796728 3300039437 Bacteria 3002
106 Ga0436365_0894992 3300039437 Bacteria 12695
107 Ga0436365_1490301 3300039437 Bacteria 2515
108 Ga0436360_0481333 3300039438 Bacteria 8475
109 Ga0436361_1113744 3300039447 Bacteria 49986
110 Ga0436363_0010528 3300039450 Bacteria 977
111 Ga0436363_1027149 3300039450 Bacteria 1807
112 Ga0436362_0477792 3300039453 Bacteria 3922
113 Ga0451577_0026160 3300042876 Bacteria 5285
114 Ga0466969_0004005 3300044656 Bacteria 7817
115 Ga0453683_0000681 3300044673 Bacteria 36046
116 Ga0466965_0014436 3300044683 Bacteria 3739
117 Ga0466966_0003314 3300044684 Bacteria 10612
118 Ga0466961_0000219 3300044693 Bacteria 38762
119 Ga0466961_0196126 3300044693 Unclassified 1250
120 Ga0466959_0003895 3300045049 Bacteria 9906
121 Ga0451576_0185942 3300045051 Bacteria 2169
122 Ga0466958_0072801 3300045836 Bacteria 2105
123 Ga0495580_0092544 3300046472 Bacteria 2104
124 Ga0495580_0122988 3300046472 Bacteria 1801
125 Ga0495580_0293240 3300046472 Bacteria 1108
126 Ga0495605_0004906 3300046474 Bacteria 7818
127 Ga0495583_0003763 3300046506 Bacteria 11274
128 Ga0495648_0017772 3300046524 Bacteria 5070
129 Ga0495674_0243547 3300047319 Bacteria 1481
130 Ga0495672_0281698 3300047320 Bacteria 794
131 Ga0495687_042287 3300047443 Bacteria 1992
132 Ga0495687_126193 3300047443 Bacteria 914
133 Ga0496100_0012016 3300048903 Bacteria 4948
134 Ga0496102_0050876 3300048905 Bacteria 3773
135 Ga0496103_0138705 3300048906 Bacteria 1554
136 Ga0496105_0684612 3300048908 Bacteria 788
137 Ga0496107_0039927 3300048910 Bacteria 3368
138 Ga0496112_0014783 3300048915 Bacteria 7258
139 Ga0496118_0003526 3300048921 Bacteria 19602
140 Ga0496121_0182720 3300048924 Bacteria 1511
141 Ga0496122_0091069 3300048925 Bacteria 2078
142 Ga0496125_0004983 3300048928 Bacteria 15015
143 Ga0496125_0007385 3300048928 Bacteria 11699
144 Ga0496126_0057767 3300048929 Bacteria 3501
145 Ga0501034_0003142 3300049571 Bacteria 18997
146 Ga0501034_0329792 3300049571 Bacteria 1458
147 Ga0501047_0002278 3300049581 Bacteria 18371
148 Ga0501047_0124157 3300049581 Bacteria 2462
149 Ga0501080_0160619 3300049742 Bacteria 2075
150 Ga0501080_0654033 3300049742 Bacteria 930
151 Ga0501044_0018587 3300049823 Bacteria 7447
152 Ga0500634_0000760 3300053161 Bacteria 11205
153 2514046338 2513237166 Bacteria 10373764
154 2563061957 2562617112 Bacteria 10918404
155 2713478207 2711768613 Bacteria 11048459
156 2904618812 2904615490 Bacteria 10047340
157 642594239 642555112 Bacteria 8676562
158 8007372713 8007371054 Bacteria 4849201
159 Ga0213876_10139739
160 JGI25406J46586_10009644
161 rootL2_10003727
162 rootL2_10346208
163 JGI25160J50197_1000130
164 Ga0065165_1000424
165 Ga0070660_100150628
166 Ga0070661_100043408
167 Ga0070659_100038734
168 Ga0070714_100024427
169 Ga0070714_100167797
170 Ga0070663_100092386
171 Ga0070681_10218253
172 Ga0070665_100309481
173 Ga0070665_100357492
174 Ga0068855_100048749
175 Ga0068856_100095949
176 Ga0068856_100132062
177 Ga0068856_100612329
178 Ga0081455_10062753
179 Ga0081539_10000847
180 Ga0105251_10046596
181 Ga0105239_10005675
182 Ga0157373_10423259
183 Ga0157369_10005640
184 Ga0157369_10034274
185 Ga0157369_10396398
186 Ga0157369_10959113
187 Ga0157374_10004635
188 Ga0157374_10005492
189 Ga0157372_10169790
190 Ga0163163_10425710
191 Ga0213872_10000742
192 Ga0213874_10118923
193 Ga0213876_10019877
194 Ga0213875_10000008
195 Ga0213875_10000065
196 Ga0213875_10001804
197 Ga0213875_10004557
198 Ga0213875_10016260
199 Ga0209564_1007394
200 Ga0207426_1000037
201 Ga0207707_10200968
202 Ga0207657_10325349
203 Ga0207664_10177381
204 Ga0207667_10040716
205 Ga0207639_10151087
206 Ga0207678_10175659
207 Ga0207702_10020494
208 Ga0207702_10075519
209 Ga0207702_10111713
210 Ga0207702_10447688
211 Ga0268266_10016790
212 Ga0265334_10000048
213 Ga0307516_10017046
214 Ga0373935_0016795
215 Ga0373947_0203225
216 Ga0373925_0024343
217 Ga0395900_0047672
218 Ga0395905_0000115
219 Ga0436364_0047161
220 Ga0436364_0059464
221 Ga0436364_0075750
222 Ga0436364_0281991
223 Ga0436364_0371847
224 Ga0436364_0454132
225 Ga0436364_0478569
226 Ga0436364_0551634
227 Ga0436364_0654010
228 Ga0436364_1013508
229 Ga0436364_1166877
230 Ga0436364_1221957
231 Ga0436364_1415525
232 Ga0436364_1547781
233 Ga0400484_04669
234 Ga0400484_14968
235 Ga0400484_27025
236 Ga0400490_10246
237 Ga0400490_44325
238 Ga0400490_51540
239 Ga0400490_51725
240 Ga0400491_07197
241 Ga0400491_11662
242 Ga0400485_01173
243 Ga0400485_11150
244 Ga0400485_15801
245 Ga0400488_06519
246 Ga0400488_54814
247 Ga0400488_60110
248 Ga0400486_11939
249 Ga0400486_21081
250 Ga0400486_22786
251 Ga0400486_27586
252 Ga0400483_001147
253 Ga0400483_048604
254 Ga0400483_101337
255 Ga0400483_150923
256 Ga0400483_166964
257 Ga0400483_203035
258 Ga0400483_216236
259 Ga0400487_27475
260 Ga0400487_39402
261 Ga0400487_65924
262 Ga0436365_0758206
263 Ga0436365_0796728
264 Ga0436365_0894992
265 Ga0436365_1490301
266 Ga0436360_0481333
267 Ga0436361_1113744
268 Ga0436363_0010528
269 Ga0436363_1027149
270 Ga0436362_0477792
271 Ga0451577_0026160
272 Ga0466969_0004005
273 Ga0453683_0000681
274 Ga0466965_0014436
275 Ga0466966_0003314
276 Ga0466961_0000219
277 Ga0466961_0196126
278 Ga0466959_0003895
279 Ga0451576_0185942
280 Ga0466958_0072801
281 Ga0495580_0092544
282 Ga0495580_0122988
283 Ga0495580_0293240
284 Ga0495605_0004906
285 Ga0495583_0003763
286 Ga0495648_0017772
287 Ga0495674_0243547
288 Ga0495672_0281698
289 Ga0495687_042287
290 Ga0495687_126193
291 Ga0496100_0012016
292 Ga0496102_0050876
293 Ga0496103_0138705
294 Ga0496105_0684612
295 Ga0496107_0039927
296 Ga0496112_0014783
297 Ga0496118_0003526
298 Ga0496121_0182720
299 Ga0496122_0091069
300 Ga0496125_0004983
301 Ga0496125_0007385
302 Ga0496126_0057767
303 Ga0501034_0003142
304 Ga0501034_0329792
305 Ga0501047_0002278
306 Ga0501047_0124157
307 Ga0501080_0160619
308 Ga0501080_0654033
309 Ga0501044_0018587
310 Ga0500634_0000760
311 2514046338
312 2563061957
313 2713478207
314 2904618812
315 642594239
316 8007372713

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

43

236

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

49

276

0.95

PF08659

KR

KR domain

43

216

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3asu-assembly1.cif.gz_A-2 crystal structure of serine dehydrogenase from escherichia coli 0.9898 1 241
3asv-assembly1.cif.gz_A the closed form of serine dehydrogenase complexed with nadp+ 0.9896 1 249
3asv-assembly1.cif.gz_A the closed form of serine dehydrogenase complexed with nadp+ 0.9856 1 249
3asu-assembly1.cif.gz_A-2 crystal structure of serine dehydrogenase from escherichia coli 0.9854 1 241
3asu-assembly1.cif.gz_B-2 crystal structure of serine dehydrogenase from escherichia coli 0.9812 1 241
ID Description Score Start End Superfamily
3asvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9888 1 249 3.40.50.720
3asvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9849 1 249 3.40.50.720
6ixjD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9654 2 249 3.40.50.720
af_O15744_2_259_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9654 2 240 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9638 90 179 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A352S319-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase 0.9968 1 224 GO:0016491
AF-A0A6L7A4L5-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG (EC 1.1.1.298) (EC 1.1.1.381) (L-allo-threonine dehydrogenase) (Malonic semialdehyde reductase) 0.9909 1 183 GO:0005829
GO:0016491
AF-A0A5N7YAK2-F1-model_v4 deleted 0.9908 1 217
AF-A0A1R1S4D1-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9907 2 249 GO:0016491
AF-Q32G40-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG (EC 1.1.1.298) (EC 1.1.1.381) (L-allo-threonine dehydrogenase) (Malonic semialdehyde reductase) 0.9899 1 249 GO:0005829
GO:0016491

Map