F229760

General Info

Members Datasets Scaffolds Average Seq Length
158 73 316 153

Family's Representative Sequence

Representative Sequence 3300020077|Ga0206351_10406240|Ga0206351_104062402
Length 173
Sequence MGPPRAGSRGQDAGTASPMSQQLNVHDLRLSSPAFDRHGRIPERHTSDGADISPPLRWSGVPAGTRSFAVIAHDPDAPLVDGFTHWVAYGIPGDRRELPEGGDGELVGINSFGNEGYNGPAPPSGHGPHHYYFWVYALDDELELPPGLDRRALLERIEDHVIEQARVIGTYEC

Samples

Sample ID Description Type Environment
1 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
16 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
18 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
19 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
20 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
29 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
30 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
31 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
32 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
33 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
34 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
35 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
36 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
37 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
38 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
39 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
40 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
41 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
42 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
43 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
44 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
45 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
46 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
47 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
48 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
49 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
50 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
51 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
52 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
53 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
54 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
55 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
56 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
57 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
58 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
59 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
60 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
61 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
63 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
64 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
65 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
66 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
67 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
68 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
69 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
70 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
71 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
72 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
73 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 1.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 0.63
Rhizosphere 80.38
Stem 0
Stem Tuber 0
Unclassified 11.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206351_10406240 3300020077 Bacteria 2280
2 Ga0070709_10011055 3300005434 Bacteria 5017
3 Ga0070709_10559699 3300005434 Unclassified 876
4 Ga0070714_100003974 3300005435 Bacteria 11118
5 Ga0070714_100028443 3300005435 Bacteria 4638
6 Ga0070714_100204151 3300005435 Bacteria 1809
7 Ga0070714_100942927 3300005435 Unclassified 839
8 Ga0070713_100022105 3300005436 Bacteria 4909
9 Ga0070713_100022329 3300005436 Bacteria 4889
10 Ga0070713_100284132 3300005436 Bacteria 1519
11 Ga0070713_100300312 3300005436 Bacteria 1478
12 Ga0070713_101661994 3300005436 Unclassified 620
13 Ga0070710_10025301 3300005437 Bacteria 3143
14 Ga0070708_100361718 3300005445 Bacteria 1367
15 Ga0070706_100492841 3300005467 Bacteria 1140
16 Ga0070707_100332658 3300005468 Unclassified 1476
17 Ga0070698_100028930 3300005471 Bacteria 5753
18 Ga0070699_100003266 3300005518 Bacteria 14347
19 Ga0070679_101040129 3300005530 Bacteria 763
20 Ga0070717_10001483 3300006028 Bacteria 16233
21 Ga0070717_10006159 3300006028 Bacteria 8808
22 Ga0070717_10020287 3300006028 Bacteria 5223
23 Ga0070717_10138394 3300006028 Bacteria 2098
24 Ga0070716_100001788 3300006173 Bacteria 9734
25 Ga0070712_100018452 3300006175 Bacteria 4532
26 Ga0070712_100408748 3300006175 Bacteria 1122
27 Ga0206354_11357979 3300020081 Bacteria 560
28 Ga0154015_1185136 3300020610 Archaea 828
29 Ga0213873_10006142 3300021358 Bacteria 2349
30 Ga0213876_10428509 3300021384 Bacteria 703
31 Ga0213875_10000628 3300021388 Bacteria 28179
32 Ga0213875_10026382 3300021388 Bacteria 2764
33 Ga0213875_10041670 3300021388 Bacteria 2160
34 Ga0213875_10056775 3300021388 Bacteria 1834
35 Ga0213875_10222573 3300021388 Bacteria 889
36 Ga0213875_10311488 3300021388 Unclassified 746
37 Ga0213875_10432759 3300021388 Bacteria 629
38 Ga0207692_10002794 3300025898 Bacteria 6740
39 Ga0207699_10000559 3300025906 Bacteria 18364
40 Ga0207684_10377726 3300025910 Bacteria 1219
41 Ga0207693_10002398 3300025915 Bacteria 16264
42 Ga0207693_10679394 3300025915 Unclassified 799
43 Ga0207646_11101043 3300025922 Unclassified 699
44 Ga0207700_10003069 3300025928 Bacteria 9645
45 Ga0207700_10096676 3300025928 Bacteria 2346
46 Ga0207700_10294645 3300025928 Bacteria 1399
47 Ga0207700_11548342 3300025928 Unclassified 587
48 Ga0207700_11726371 3300025928 Unclassified 552
49 Ga0207664_10001344 3300025929 Bacteria 16158
50 Ga0207664_10001774 3300025929 Bacteria 14205
51 Ga0207664_10341079 3300025929 Bacteria 1325
52 Ga0207664_11049328 3300025929 Bacteria 730
53 Ga0207664_11609652 3300025929 Bacteria 572
54 Ga0207665_10002723 3300025939 Bacteria 11857
55 Ga0307408_100164049 3300031548 Bacteria 1768
56 Ga0316579_10205607 3300031691 Bacteria 952
57 Ga0316576_10171683 3300031727 Bacteria 1636
58 Ga0316576_10778803 3300031727 Bacteria 689
59 Ga0316578_10006488 3300031728 Bacteria 5781
60 Ga0316577_10068345 3300031733 Unclassified 1984
61 Ga0307416_100288526 3300032002 Bacteria 1623
62 Ga0307415_100215273 3300032126 Bacteria 1536
63 Ga0316583_10037556 3300032133 Unclassified 1717
64 Ga0316584_0014630 3300036712 Bacteria 5593
65 Ga0436364_0046100 3300037853 Bacteria 33608
66 Ga0436364_0104905 3300037853 Bacteria 903
67 Ga0436364_0141559 3300037853 Bacteria 12383
68 Ga0436364_0201909 3300037853 Bacteria 3598
69 Ga0436364_0345633 3300037853 Bacteria 1020
70 Ga0436364_0668712 3300037853 Bacteria 1050
71 Ga0436364_0891364 3300037853 Bacteria 629
72 Ga0436364_1285828 3300037853 Bacteria 1284
73 Ga0436364_1335425 3300037853 Bacteria 1992
74 Ga0436364_1391075 3300037853 Unclassified 605
75 Ga0436364_1484319 3300037853 Bacteria 3954
76 Ga0436365_0040915 3300039437 Bacteria 20912
77 Ga0436365_0651354 3300039437 Bacteria 2793
78 Ga0436365_0797007 3300039437 Bacteria 747
79 Ga0436365_1036393 3300039437 Unclassified 1276
80 Ga0436363_0135964 3300039450 Bacteria 637
81 Ga0436363_1113347 3300039450 Bacteria 1109
82 Ga0436363_1549363 3300039450 Bacteria 2017
83 Ga0436362_0586122 3300039453 Bacteria 925
84 Ga0436362_0944139 3300039453 Bacteria 3989
85 Ga0451837_1761235 3300041494 Bacteria 1934
86 Ga0451843_0716028 3300041509 Bacteria 2530
87 Ga0466969_0007327 3300044656 Bacteria 5865
88 Ga0466965_0170743 3300044683 Unclassified 1144
89 Ga0466965_0191434 3300044683 Bacteria 1082
90 Ga0466965_0318072 3300044683 Bacteria 847
91 Ga0466965_0530421 3300044683 Bacteria 663
92 Ga0466966_0031545 3300044684 Bacteria 3436
93 Ga0466966_0046703 3300044684 Bacteria 2764
94 Ga0466966_0447863 3300044684 Bacteria 776
95 Ga0466966_0989324 3300044684 Unclassified 507
96 Ga0466961_0005654 3300044693 Bacteria 7902
97 Ga0466963_0000898 3300044694 Bacteria 15141
98 Ga0466963_0004767 3300044694 Bacteria 7909
99 Ga0466963_0010786 3300044694 Bacteria 5548
100 Ga0466963_0015948 3300044694 Bacteria 4664
101 Ga0466963_0094059 3300044694 Bacteria 2044
102 Ga0466963_0158207 3300044694 Bacteria 1576
103 Ga0466963_0346646 3300044694 Bacteria 1046
104 Ga0466963_0389245 3300044694 Bacteria 983
105 Ga0466964_0555779 3300044706 Bacteria 624
106 Ga0466971_0009974 3300044719 Bacteria 4150
107 Ga0466971_0339563 3300044719 Bacteria 726
108 Ga0466968_0009488 3300044735 Bacteria 3743
109 Ga0466968_0023167 3300044735 Bacteria 2528
110 Ga0466968_0027550 3300044735 Bacteria 2339
111 Ga0466968_0042294 3300044735 Unclassified 1926
112 Ga0466968_0079034 3300044735 Bacteria 1443
113 Ga0466968_0193644 3300044735 Bacteria 950
114 Ga0466970_0008519 3300044765 Bacteria 5164
115 Ga0466970_0236133 3300044765 Unclassified 1022
116 Ga0466970_0500062 3300044765 Bacteria 700
117 Ga0466970_0705918 3300044765 Bacteria 588
118 Ga0466957_0007503 3300044842 Bacteria 6162
119 Ga0466957_0100523 3300044842 Bacteria 1823
120 Ga0466957_0500529 3300044842 Bacteria 842
121 Ga0466959_0005346 3300045049 Bacteria 8785
122 Ga0466959_0005644 3300045049 Bacteria 8608
123 Ga0466959_0013428 3300045049 Bacteria 5936
124 Ga0466959_0707962 3300045049 Bacteria 675
125 Ga0466958_0003806 3300045836 Bacteria 7881
126 Ga0466958_0058037 3300045836 Bacteria 2353
127 Ga0466958_0058723 3300045836 Bacteria 2339
128 Ga0466958_0215135 3300045836 Bacteria 1225
129 Ga0466958_0238550 3300045836 Bacteria 1162
130 Ga0466958_0473843 3300045836 Bacteria 811
131 Ga0466958_0633546 3300045836 Bacteria 696
132 Ga0466967_0010344 3300045976 Bacteria 6993
133 Ga0466967_0037658 3300045976 Bacteria 4141
134 Ga0466967_0099297 3300045976 Bacteria 2659
135 Ga0466967_0266902 3300045976 Bacteria 1639
136 Ga0466967_0357536 3300045976 Bacteria 1414
137 Ga0495628_0089862 3300046516 Bacteria 2378
138 Ga0495645_0520972 3300046543 Unclassified 741
139 Ga0495599_0236859 3300046678 Bacteria 1114
140 Ga0495599_0257790 3300046678 Bacteria 1060
141 Ga0495646_0226996 3300046680 Bacteria 1008
142 Ga0496109_0479231 3300048912 Bacteria 1175
143 Ga0501047_0258861 3300049581 Bacteria 1588
144 Ga0501069_0023281 3300049585 Bacteria 3377
145 Ga0501070_0038388 3300049586 Bacteria 3995
146 Ga0501070_0236058 3300049586 Bacteria 1497
147 Ga0501071_0155431 3300049587 Bacteria 1708
148 Ga0501072_0060121 3300049588 Bacteria 2997
149 Ga0501073_0022781 3300049589 Bacteria 4506
150 Ga0501074_0264963 3300049590 Bacteria 1221
151 Ga0501080_0028451 3300049742 Bacteria 5199
152 nmdc:mga03n38_435426_c1 3300050490 Bacteria 727
153 nmdc:mga03n38_635172_c1 3300050490 Bacteria 611
154 Ga0495612_0539239 3300053078 Bacteria 537
155 Ga0495619_0351108 3300053085 Bacteria 1020
156 Ga0501082_1074477 3300060353 Bacteria 704
157 Ga0466962_0110826 3300061719 Bacteria 1321
158 Ga0466962_0197585 3300061719 Bacteria 982
159 Ga0206351_10406240
160 Ga0070709_10011055
161 Ga0070709_10559699
162 Ga0070714_100003974
163 Ga0070714_100028443
164 Ga0070714_100204151
165 Ga0070714_100942927
166 Ga0070713_100022105
167 Ga0070713_100022329
168 Ga0070713_100284132
169 Ga0070713_100300312
170 Ga0070713_101661994
171 Ga0070710_10025301
172 Ga0070708_100361718
173 Ga0070706_100492841
174 Ga0070707_100332658
175 Ga0070698_100028930
176 Ga0070699_100003266
177 Ga0070679_101040129
178 Ga0070717_10001483
179 Ga0070717_10006159
180 Ga0070717_10020287
181 Ga0070717_10138394
182 Ga0070716_100001788
183 Ga0070712_100018452
184 Ga0070712_100408748
185 Ga0206354_11357979
186 Ga0154015_1185136
187 Ga0213873_10006142
188 Ga0213876_10428509
189 Ga0213875_10000628
190 Ga0213875_10026382
191 Ga0213875_10041670
192 Ga0213875_10056775
193 Ga0213875_10222573
194 Ga0213875_10311488
195 Ga0213875_10432759
196 Ga0207692_10002794
197 Ga0207699_10000559
198 Ga0207684_10377726
199 Ga0207693_10002398
200 Ga0207693_10679394
201 Ga0207646_11101043
202 Ga0207700_10003069
203 Ga0207700_10096676
204 Ga0207700_10294645
205 Ga0207700_11548342
206 Ga0207700_11726371
207 Ga0207664_10001344
208 Ga0207664_10001774
209 Ga0207664_10341079
210 Ga0207664_11049328
211 Ga0207664_11609652
212 Ga0207665_10002723
213 Ga0307408_100164049
214 Ga0316579_10205607
215 Ga0316576_10171683
216 Ga0316576_10778803
217 Ga0316578_10006488
218 Ga0316577_10068345
219 Ga0307416_100288526
220 Ga0307415_100215273
221 Ga0316583_10037556
222 Ga0316584_0014630
223 Ga0436364_0046100
224 Ga0436364_0104905
225 Ga0436364_0141559
226 Ga0436364_0201909
227 Ga0436364_0345633
228 Ga0436364_0668712
229 Ga0436364_0891364
230 Ga0436364_1285828
231 Ga0436364_1335425
232 Ga0436364_1391075
233 Ga0436364_1484319
234 Ga0436365_0040915
235 Ga0436365_0651354
236 Ga0436365_0797007
237 Ga0436365_1036393
238 Ga0436363_0135964
239 Ga0436363_1113347
240 Ga0436363_1549363
241 Ga0436362_0586122
242 Ga0436362_0944139
243 Ga0451837_1761235
244 Ga0451843_0716028
245 Ga0466969_0007327
246 Ga0466965_0170743
247 Ga0466965_0191434
248 Ga0466965_0318072
249 Ga0466965_0530421
250 Ga0466966_0031545
251 Ga0466966_0046703
252 Ga0466966_0447863
253 Ga0466966_0989324
254 Ga0466961_0005654
255 Ga0466963_0000898
256 Ga0466963_0004767
257 Ga0466963_0010786
258 Ga0466963_0015948
259 Ga0466963_0094059
260 Ga0466963_0158207
261 Ga0466963_0346646
262 Ga0466963_0389245
263 Ga0466964_0555779
264 Ga0466971_0009974
265 Ga0466971_0339563
266 Ga0466968_0009488
267 Ga0466968_0023167
268 Ga0466968_0027550
269 Ga0466968_0042294
270 Ga0466968_0079034
271 Ga0466968_0193644
272 Ga0466970_0008519
273 Ga0466970_0236133
274 Ga0466970_0500062
275 Ga0466970_0705918
276 Ga0466957_0007503
277 Ga0466957_0100523
278 Ga0466957_0500529
279 Ga0466959_0005346
280 Ga0466959_0005644
281 Ga0466959_0013428
282 Ga0466959_0707962
283 Ga0466958_0003806
284 Ga0466958_0058037
285 Ga0466958_0058723
286 Ga0466958_0215135
287 Ga0466958_0238550
288 Ga0466958_0473843
289 Ga0466958_0633546
290 Ga0466967_0010344
291 Ga0466967_0037658
292 Ga0466967_0099297
293 Ga0466967_0266902
294 Ga0466967_0357536
295 Ga0495628_0089862
296 Ga0495645_0520972
297 Ga0495599_0236859
298 Ga0495599_0257790
299 Ga0495646_0226996
300 Ga0496109_0479231
301 Ga0501047_0258861
302 Ga0501069_0023281
303 Ga0501070_0038388
304 Ga0501070_0236058
305 Ga0501071_0155431
306 Ga0501072_0060121
307 Ga0501073_0022781
308 Ga0501074_0264963
309 Ga0501080_0028451
310 nmdc:mga03n38_435426_c1
311 nmdc:mga03n38_635172_c1
312 Ga0495612_0539239
313 Ga0495619_0351108
314 Ga0501082_1074477
315 Ga0466962_0110826
316 Ga0466962_0197585

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01161

PBP

Phosphatidylethanolamine-binding protein

40

171

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n08-assembly1.cif.gz_B crystal structure of a putative phosphatidylethanolamine-binding protein (pebp) homolog ct736 from chlamydia trachomatis d/uw-3/cx 0.9309 8 154
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.9254 8 153
1vi3-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.9203 7 154
4beg-assembly1.cif.gz_A structure of rv2140c, a phosphatidyl-ethanolamine binding protein from mycobacterium tuberculosis in complex with sulphate 0.9198 5 153
1fux-assembly1.cif.gz_B crystal structure of e.coli ybcl, a new member of the mammalian pebp family 0.9174 6 153
ID Description Score Start End Superfamily
3n08A00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9318 6 154 3.90.280.10
4begB00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9211 5 153 3.90.280.10
1fjjA00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.916 9 150 3.90.280.10
3n08A00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.914 6 154 3.90.280.10
af_P77368_20_183_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9086 6 153 3.90.280.10
ID Description Score Start End GO Terms
AF-A0A3M1VFQ5-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9641 7 154
AF-R4YZV4-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9621 5 154
AF-A0A3D0N8A0-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.962 8 154
AF-A0A1F2VDT6-F1-model_v4 Phosphatidylethanolamine-binding protein 0.9618 9 156
AF-A0A0K1PHS6-F1-model_v4 Phospholipid-binding protein 0.9616 9 154

Map