F228257

General Info

Members Datasets Scaffolds Average Seq Length
157 95 157 173

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0028321|Ga0501032_0028321_2840_3361
Length 173
Sequence MLQLSDALLRKSVLSLRTGAPVATIIAPIFNPNNLRIEGFYCQDRFEKKKQLVLLCQDIRDIMPDGYVINDHEVLAEPEDLVRLKKIIALNFELLGKQVVTVDKQKVGKVSDYATDLDTMYVQKLYVAQSILKNLAGGSLSIDRSQINEITPRRIIINELIKKAPASAQAVIS

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
63 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
70 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
71 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
83 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
84 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
85 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
86 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
87 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
88 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
89 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
90 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
91 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
92 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
93 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
94 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
95 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.01
Nodule 0
Rhizoplane 0.64
Rhizosphere 89.81
Stem 0
Stem Tuber 0
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10361249 3300003322 Bacteria 1633
2 rootH1_10155066 3300003323 Bacteria 1976
3 Ga0070658_10000110 3300005327 Bacteria 73137
4 Ga0070658_10000523 3300005327 Bacteria 33292
5 Ga0070658_10000731 3300005327 Bacteria 28257
6 Ga0070658_10062572 3300005327 Bacteria 3033
7 Ga0070680_100002001 3300005336 Bacteria 15004
8 Ga0070680_100005933 3300005336 Bacteria 9270
9 Ga0070682_100021655 3300005337 Bacteria 3797
10 Ga0070682_100053077 3300005337 Bacteria 2539
11 Ga0070682_100795201 3300005337 Unclassified 768
12 Ga0068868_100558891 3300005338 Bacteria 1009
13 Ga0070660_100000549 3300005339 Bacteria 25128
14 Ga0070671_100000001 3300005355 Bacteria 1228151
15 Ga0070674_100099323 3300005356 Bacteria 2117
16 Ga0070659_100076277 3300005366 Bacteria 2673
17 Ga0070663_100061562 3300005455 Bacteria 2703
18 Ga0070681_10003136 3300005458 Bacteria 15358
19 Ga0068867_100222654 3300005459 Bacteria 1521
20 Ga0070679_100000413 3300005530 Bacteria 36391
21 Ga0070679_100022716 3300005530 Bacteria 6133
22 Ga0070679_100538582 3300005530 Bacteria 1111
23 Ga0070684_100000345 3300005535 Bacteria 31913
24 Ga0070684_100221708 3300005535 Unclassified 1725
25 Ga0070672_100005181 3300005543 Bacteria 8618
26 Ga0070665_100128469 3300005548 Bacteria 2537
27 Ga0068855_100037696 3300005563 Bacteria 5747
28 Ga0068855_100651411 3300005563 Unclassified 1131
29 Ga0068857_100029056 3300005577 Bacteria 4878
30 Ga0068856_100012059 3300005614 Bacteria 8374
31 Ga0068856_100319700 3300005614 Bacteria 1569
32 Ga0068856_100537868 3300005614 Unclassified 1189
33 Ga0068856_100891585 3300005614 Unclassified 908
34 Ga0075366_10000028 3300006195 Bacteria 50296
35 Ga0105240_10000003 3300009093 Bacteria 1183681
36 Ga0105245_10000034 3300009098 Bacteria 147951
37 Ga0105245_10003608 3300009098 Bacteria 13810
38 Ga0105245_10194237 3300009098 Bacteria 1946
39 Ga0105245_11666552 3300009098 Unclassified 690
40 Ga0105247_11128772 3300009101 Unclassified 620
41 Ga0105243_10000001 3300009148 Bacteria 1156578
42 Ga0105242_10000001 3300009176 Bacteria 574039
43 Ga0105242_10243067 3300009176 Bacteria 1619
44 Ga0105237_10035499 3300009545 Bacteria 5045
45 Ga0105237_10131180 3300009545 Bacteria 2500
46 Ga0105030_108095 3300009987 Unclassified 893
47 Ga0105239_10059162 3300010375 Bacteria 4206
48 Ga0105239_10075049 3300010375 Bacteria 3717
49 Ga0105239_10650823 3300010375 Unclassified 1204
50 Ga0157373_10030946 3300013100 Bacteria 3851
51 Ga0157369_10019684 3300013105 Bacteria 7554
52 Ga0157369_10538175 3300013105 Unclassified 1208
53 Ga0157369_11001379 3300013105 Unclassified 856
54 Ga0157374_10001007 3300013296 Bacteria 24406
55 Ga0157374_10497970 3300013296 Bacteria 1223
56 Ga0157374_10896240 3300013296 Unclassified 904
57 Ga0157374_11557124 3300013296 Unclassified 685
58 Ga0157378_10031969 3300013297 Bacteria 4649
59 Ga0157372_10011914 3300013307 Bacteria 9264
60 Ga0157372_10810778 3300013307 Unclassified 1087
61 Ga0157377_10041293 3300014745 Bacteria 2558
62 Ga0157376_10000001 3300014969 Bacteria 842910
63 Ga0207645_10056682 3300025907 Bacteria 2501
64 Ga0207705_10000019 3300025909 Bacteria 317770
65 Ga0207705_10000227 3300025909 Bacteria 55933
66 Ga0207705_10000277 3300025909 Bacteria 49020
67 Ga0207705_10038474 3300025909 Bacteria 3425
68 Ga0207705_10043754 3300025909 Bacteria 3217
69 Ga0207707_10017167 3300025912 Bacteria 6308
70 Ga0207707_10584433 3300025912 Unclassified 946
71 Ga0207695_10000005 3300025913 Bacteria 1196715
72 Ga0207695_10145923 3300025913 Unclassified 2310
73 Ga0207671_10218883 3300025914 Bacteria 1491
74 Ga0207660_10000989 3300025917 Bacteria 18843
75 Ga0207657_10004709 3300025919 Bacteria 14395
76 Ga0207657_10026819 3300025919 Bacteria 5286
77 Ga0207657_10910051 3300025919 Unclassified 677
78 Ga0207652_10002857 3300025921 Bacteria 14455
79 Ga0207652_10010943 3300025921 Bacteria 7314
80 Ga0207687_10020537 3300025927 Bacteria 4382
81 Ga0207687_11247841 3300025927 Unclassified 639
82 Ga0207644_10000001 3300025931 Bacteria 1243214
83 Ga0207690_10306268 3300025932 Bacteria 1245
84 Ga0207686_10000001 3300025934 Bacteria 1169580
85 Ga0207709_10000002 3300025935 Bacteria 1171536
86 Ga0207669_10014079 3300025937 Bacteria 3999
87 Ga0207691_10068049 3300025940 Bacteria 3218
88 Ga0207667_10581227 3300025949 Unclassified 1131
89 Ga0207667_10652687 3300025949 Bacteria 1058
90 Ga0207651_10004922 3300025960 Bacteria 6813
91 Ga0207702_10054187 3300026078 Bacteria 3398
92 Ga0207702_10179659 3300026078 Bacteria 1948
93 Ga0207702_10486412 3300026078 Unclassified 1202
94 Ga0207702_10813536 3300026078 Unclassified 924
95 Ga0207648_10093651 3300026089 Bacteria 2627
96 Ga0207674_10017176 3300026116 Bacteria 7897
97 Ga0207683_10059415 3300026121 Bacteria 3359
98 Ga0207698_10230020 3300026142 Bacteria 1682
99 Ga0268266_10101264 3300028379 Bacteria 2539
100 Ga0265338_10001602 3300028800 Bacteria 36326
101 Ga0265327_10000025 3300031251 Bacteria 380054
102 Ga0265342_10066891 3300031712 Bacteria 2104
103 Ga0373925_0250657 3300037068 Bacteria 1420
104 Ga0395899_0015480 3300037312 Bacteria 5815
105 Ga0395899_0015610 3300037312 Bacteria 5790
106 Ga0395899_0225025 3300037312 Unclassified 1298
107 Ga0395900_0000712 3300037418 Bacteria 44237
108 Ga0395900_0206111 3300037418 Bacteria 1987
109 Ga0395900_0231399 3300037418 Bacteria 1858
110 Ga0395900_0283261 3300037418 Bacteria 1649
111 Ga0395898_0003669 3300037466 Bacteria 17057
112 Ga0395898_0005045 3300037466 Bacteria 14315
113 Ga0395898_0247182 3300037466 Unclassified 1701
114 Ga0395905_0000406 3300037471 Bacteria 60907
115 Ga0395905_0000943 3300037471 Bacteria 37400
116 Ga0395905_0058318 3300037471 Bacteria 3610
117 Ga0395905_1145151 3300037471 Unclassified 681
118 Ga0395905_1536722 3300037471 Unclassified 570
119 Ga0395901_0000862 3300038443 Bacteria 33400
120 Ga0395901_0017081 3300038443 Bacteria 7397
121 Ga0395901_0034900 3300038443 Bacteria 5195
122 Ga0395901_0101185 3300038443 Unclassified 3024
123 Ga0395901_0377437 3300038443 Unclassified 1460
124 Ga0496112_0024151 3300048915 Bacteria 5818
125 Ga0496126_0080030 3300048929 Bacteria 2892
126 Ga0496126_0378493 3300048929 Unclassified 1153
127 Ga0501031_0000777 3300049568 Bacteria 19155
128 Ga0501032_0000641 3300049569 Bacteria 28409
129 Ga0501032_0028321 3300049569 Bacteria 3850
130 Ga0501034_0001383 3300049571 Bacteria 32637
131 Ga0501034_0003364 3300049571 Bacteria 18261
132 Ga0501037_0000138 3300049573 Bacteria 68040
133 Ga0501038_0000863 3300049574 Bacteria 26878
134 Ga0501039_0438856 3300049575 Bacteria 1025
135 Ga0501042_0079903 3300049578 Unclassified 2343
136 Ga0501043_0000062 3300049579 Bacteria 95664
137 Ga0501046_0000059 3300049580 Bacteria 126801
138 Ga0501047_0000032 3300049581 Bacteria 208294
139 Ga0501047_0000057 3300049581 Bacteria 140059
140 Ga0501048_0000001 3300049582 Bacteria 132132
141 Ga0501048_0023031 3300049582 Bacteria 4553
142 Ga0501069_0034405 3300049585 Unclassified 2791
143 Ga0501070_0018726 3300049586 Bacteria 5809
144 Ga0501083_0114212 3300049744 Unclassified 1773
145 Ga0501083_0243378 3300049744 Bacteria 1171
146 Ga0501035_0000005 3300049822 Bacteria 392980
147 Ga0501035_0001735 3300049822 Bacteria 22038
148 Ga0500644_0004168 3300053088 Unclassified 3605
149 Ga0500646_0000252 3300053090 Bacteria 16405
150 Ga0500583_0010042 3300053092 Unclassified 3492
151 Ga0500650_0000001 3300053098 Bacteria 818797
152 Ga0500562_078081 3300053108 Bacteria 895
153 Ga0500594_0000001 3300053118 Bacteria 1178472
154 Ga0500628_000477 3300053129 Bacteria 7491
155 Ga0500655_003661 3300053133 Bacteria 2768
156 Ga0500577_0000179 3300053142 Bacteria 16337
157 Ga0500633_0000190 3300053160 Bacteria 8606

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_1536722 Ga0395905_1536722_45_536 163
2 3300037312 Ga0395899_0015610 Ga0395899_0015610_3433_3948 166
3 3300037466 Ga0395898_0005045 Ga0395898_0005045_1987_2502 166
4 3300037471 Ga0395905_0000943 Ga0395905_0000943_25_540 166
5 3300038443 Ga0395901_0034900 Ga0395901_0034900_1095_1610 166
6 3300003323 rootH1_10155066 rootH1_101550662 171
7 3300005327 Ga0070658_10000523 Ga0070658_1000052330 171
8 3300005327 Ga0070658_10062572 Ga0070658_100625724 171
9 3300005336 Ga0070680_100002001 Ga0070680_10000200115 171
10 3300005337 Ga0070682_100053077 Ga0070682_1000530774 171
11 3300005337 Ga0070682_100795201 Ga0070682_1007952012 171
12 3300005338 Ga0068868_100558891 Ga0068868_1005588912 171
13 3300005339 Ga0070660_100000549 Ga0070660_1000005496 171
14 3300005356 Ga0070674_100099323 Ga0070674_1000993232 171
15 3300005366 Ga0070659_100076277 Ga0070659_1000762772 171
16 3300005455 Ga0070663_100061562 Ga0070663_1000615624 171
17 3300005458 Ga0070681_10003136 Ga0070681_1000313611 171
18 3300005459 Ga0068867_100222654 Ga0068867_1002226542 171
19 3300005530 Ga0070679_100000413 Ga0070679_10000041328 171
20 3300005530 Ga0070679_100022716 Ga0070679_1000227165 171
21 3300005530 Ga0070679_100538582 Ga0070679_1005385822 171
22 3300005535 Ga0070684_100221708 Ga0070684_1002217082 171
23 3300005543 Ga0070672_100005181 Ga0070672_1000051817 171
24 3300005548 Ga0070665_100128469 Ga0070665_1001284692 171
25 3300005577 Ga0068857_100029056 Ga0068857_1000290562 171
26 3300005614 Ga0068856_100012059 Ga0068856_1000120598 171
27 3300005614 Ga0068856_100319700 Ga0068856_1003197002 171
28 3300005614 Ga0068856_100891585 Ga0068856_1008915852 171
29 3300006195 Ga0075366_10000028 Ga0075366_1000002846 171
30 3300009093 Ga0105240_10000003 Ga0105240_10000003319 171
31 3300009098 Ga0105245_10000034 Ga0105245_10000034147 171
32 3300009098 Ga0105245_10003608 Ga0105245_1000360818 171
33 3300009098 Ga0105245_10194237 Ga0105245_101942373 171
34 3300009148 Ga0105243_10000001 Ga0105243_10000001932 171
35 3300009176 Ga0105242_10000001 Ga0105242_10000001327 171
36 3300009545 Ga0105237_10035499 Ga0105237_100354992 171
37 3300009545 Ga0105237_10131180 Ga0105237_101311805 171
38 3300009987 Ga0105030_108095 Ga0105030_1080952 171
39 3300010375 Ga0105239_10059162 Ga0105239_100591622 171
40 3300010375 Ga0105239_10075049 Ga0105239_100750492 171
41 3300010375 Ga0105239_10650823 Ga0105239_106508232 171
42 3300013105 Ga0157369_10019684 Ga0157369_100196847 171
43 3300013105 Ga0157369_10538175 Ga0157369_105381751 171
44 3300013105 Ga0157369_11001379 Ga0157369_110013791 171
45 3300013296 Ga0157374_10001007 Ga0157374_1000100711 171
46 3300013296 Ga0157374_10497970 Ga0157374_104979702 171
47 3300013296 Ga0157374_10896240 Ga0157374_108962401 171
48 3300013296 Ga0157374_11557124 Ga0157374_115571241 171
49 3300013297 Ga0157378_10031969 Ga0157378_100319695 171
50 3300013307 Ga0157372_10011914 Ga0157372_100119145 171
51 3300013307 Ga0157372_10810778 Ga0157372_108107782 171
52 3300014745 Ga0157377_10041293 Ga0157377_100412931 171
53 3300014969 Ga0157376_10000001 Ga0157376_10000001584 171
54 3300025907 Ga0207645_10056682 Ga0207645_100566821 171
55 3300025909 Ga0207705_10000277 Ga0207705_1000027741 171
56 3300025909 Ga0207705_10038474 Ga0207705_100384745 171
57 3300025909 Ga0207705_10043754 Ga0207705_100437542 171
58 3300025912 Ga0207707_10017167 Ga0207707_100171676 171
59 3300025912 Ga0207707_10584433 Ga0207707_105844332 171
60 3300025913 Ga0207695_10000005 Ga0207695_10000005327 171
61 3300025914 Ga0207671_10218883 Ga0207671_102188832 171
62 3300025919 Ga0207657_10026819 Ga0207657_100268192 171
63 3300025919 Ga0207657_10910051 Ga0207657_109100511 171
64 3300025921 Ga0207652_10010943 Ga0207652_100109432 171
65 3300025927 Ga0207687_10020537 Ga0207687_100205374 171
66 3300025927 Ga0207687_11247841 Ga0207687_112478411 171
67 3300025932 Ga0207690_10306268 Ga0207690_103062682 171
68 3300025934 Ga0207686_10000001 Ga0207686_10000001210 171
69 3300025935 Ga0207709_10000002 Ga0207709_10000002327 171
70 3300025937 Ga0207669_10014079 Ga0207669_100140794 171
71 3300025940 Ga0207691_10068049 Ga0207691_100680494 171
72 3300025960 Ga0207651_10004922 Ga0207651_100049226 171
73 3300026078 Ga0207702_10054187 Ga0207702_100541875 171
74 3300026078 Ga0207702_10813536 Ga0207702_108135362 171
75 3300026089 Ga0207648_10093651 Ga0207648_100936512 171
76 3300026116 Ga0207674_10017176 Ga0207674_100171769 171
77 3300026121 Ga0207683_10059415 Ga0207683_100594153 171
78 3300028379 Ga0268266_10101264 Ga0268266_101012642 171
79 3300028800 Ga0265338_10001602 Ga0265338_1000160221 171
80 3300031251 Ga0265327_10000025 Ga0265327_10000025250 171
81 3300031712 Ga0265342_10066891 Ga0265342_100668911 171
82 3300037068 Ga0373925_0250657 Ga0373925_0250657_17_532 171
83 3300037312 Ga0395899_0225025 Ga0395899_0225025_620_1135 171
84 3300037418 Ga0395900_0283261 Ga0395900_0283261_486_1001 171
85 3300037471 Ga0395905_0000406 Ga0395905_0000406_40060_40575 171
86 3300037471 Ga0395905_1145151 Ga0395905_1145151_128_643 171
87 3300038443 Ga0395901_0000862 Ga0395901_0000862_26190_26705 171
88 3300038443 Ga0395901_0377437 Ga0395901_0377437_14_529 171
89 3300048915 Ga0496112_0024151 Ga0496112_0024151_818_1333 171
90 3300048929 Ga0496126_0080030 Ga0496126_0080030_1057_1572 171
91 3300053088 Ga0500644_0004168 Ga0500644_0004168_1328_1843 171
92 3300053090 Ga0500646_0000252 Ga0500646_0000252_14074_14589 171
93 3300053092 Ga0500583_0010042 Ga0500583_0010042_1213_1728 171
94 3300053098 Ga0500650_0000001 Ga0500650_0000001_60687_61202 171
95 3300053108 Ga0500562_078081 Ga0500562_078081_330_845 171
96 3300053118 Ga0500594_0000001 Ga0500594_0000001_725487_726002 171
97 3300053133 Ga0500655_003661 Ga0500655_003661_174_689 171
98 3300053142 Ga0500577_0000179 Ga0500577_0000179_3801_4316 171
99 3300053160 Ga0500633_0000190 Ga0500633_0000190_3175_3690 171
100 3300005327 Ga0070658_10000110 Ga0070658_1000011030 172
101 3300005327 Ga0070658_10000731 Ga0070658_1000073116 172
102 3300005336 Ga0070680_100005933 Ga0070680_10000593312 172
103 3300005337 Ga0070682_100021655 Ga0070682_1000216552 172
104 3300005355 Ga0070671_100000001 Ga0070671_100000001971 172
105 3300005535 Ga0070684_100000345 Ga0070684_1000003458 172
106 3300005563 Ga0068855_100037696 Ga0068855_1000376965 172
107 3300005563 Ga0068855_100651411 Ga0068855_1006514112 172
108 3300005614 Ga0068856_100537868 Ga0068856_1005378682 172
109 3300009098 Ga0105245_11666552 Ga0105245_116665521 172
110 3300009101 Ga0105247_11128772 Ga0105247_111287721 172
111 3300009176 Ga0105242_10243067 Ga0105242_102430672 172
112 3300013100 Ga0157373_10030946 Ga0157373_100309463 172
113 3300025909 Ga0207705_10000019 Ga0207705_1000001922 172
114 3300025909 Ga0207705_10000227 Ga0207705_100002277 172
115 3300025913 Ga0207695_10145923 Ga0207695_101459231 172
116 3300025917 Ga0207660_10000989 Ga0207660_1000098919 172
117 3300025919 Ga0207657_10004709 Ga0207657_1000470915 172
118 3300025921 Ga0207652_10002857 Ga0207652_100028572 172
119 3300025931 Ga0207644_10000001 Ga0207644_10000001466 172
120 3300025949 Ga0207667_10581227 Ga0207667_105812272 172
121 3300025949 Ga0207667_10652687 Ga0207667_106526872 172
122 3300026078 Ga0207702_10179659 Ga0207702_101796593 172
123 3300026078 Ga0207702_10486412 Ga0207702_104864122 172
124 3300026142 Ga0207698_10230020 Ga0207698_102300201 172
125 3300037312 Ga0395899_0015480 Ga0395899_0015480_3702_4220 172
126 3300037418 Ga0395900_0000712 Ga0395900_0000712_15035_15553 172
127 3300037418 Ga0395900_0206111 Ga0395900_0206111_1220_1738 172
128 3300037418 Ga0395900_0231399 Ga0395900_0231399_291_809 172
129 3300037466 Ga0395898_0003669 Ga0395898_0003669_5160_5678 172
130 3300037466 Ga0395898_0247182 Ga0395898_0247182_630_1148 172
131 3300037471 Ga0395905_0058318 Ga0395905_0058318_990_1508 172
132 3300038443 Ga0395901_0017081 Ga0395901_0017081_4379_4897 172
133 3300038443 Ga0395901_0101185 Ga0395901_0101185_2103_2621 172
134 3300048929 Ga0496126_0378493 Ga0496126_0378493_508_1029 172
135 3300049568 Ga0501031_0000777 Ga0501031_0000777_16928_17446 172
136 3300049569 Ga0501032_0000641 Ga0501032_0000641_21422_21940 172
137 3300049569 Ga0501032_0028321 Ga0501032_0028321_2840_3361 172
138 3300049571 Ga0501034_0001383 Ga0501034_0001383_25873_26391 172
139 3300049571 Ga0501034_0003364 Ga0501034_0003364_68_589 172
140 3300049573 Ga0501037_0000138 Ga0501037_0000138_34809_35327 172
141 3300049574 Ga0501038_0000863 Ga0501038_0000863_4278_4796 172
142 3300049575 Ga0501039_0438856 Ga0501039_0438856_405_926 172
143 3300049578 Ga0501042_0079903 Ga0501042_0079903_253_771 172
144 3300049579 Ga0501043_0000062 Ga0501043_0000062_72970_73488 172
145 3300049580 Ga0501046_0000059 Ga0501046_0000059_52642_53160 172
146 3300049581 Ga0501047_0000032 Ga0501047_0000032_185294_185812 172
147 3300049581 Ga0501047_0000057 Ga0501047_0000057_104679_105200 172
148 3300049582 Ga0501048_0000001 Ga0501048_0000001_8941_9459 172
149 3300049582 Ga0501048_0023031 Ga0501048_0023031_2861_3382 172
150 3300049585 Ga0501069_0034405 Ga0501069_0034405_1640_2158 172
151 3300049586 Ga0501070_0018726 Ga0501070_0018726_3740_4258 172
152 3300049744 Ga0501083_0114212 Ga0501083_0114212_1168_1686 172
153 3300049744 Ga0501083_0243378 Ga0501083_0243378_358_879 172
154 3300049822 Ga0501035_0000005 Ga0501035_0000005_280902_281423 172
155 3300049822 Ga0501035_0001735 Ga0501035_0001735_18567_19085 172
156 3300053129 Ga0500628_000477 Ga0500628_000477_6218_6736 172
157 3300003322 rootL2_10361249 rootL2_103612493 173

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ddq-assembly1.cif.gz_H structure of rc-lh1-pufx from rhodobacter veldkampii 0.8809 93 157
8b64-assembly1.cif.gz_H cryo-em structure of rc-lh1-pufx photosynthetic core complex from rba. capsulatus 0.873 93 158
7yml-assembly1.cif.gz_H structure of photosynthetic lh1-rc super-complex of rhodobacter capsulatus 0.8722 92 158
1dxr-assembly1.cif.gz_H photosynthetic reaction center from rhodopseudomonas viridis - his l168 phe mutant (terbutryn complex) 0.8706 92 158
2gmr-assembly1.cif.gz_H photosynthetic reaction center mutant from rhodobacter sphaeroides with asp l210 replaced with asn 0.8676 93 158
ID Description Score Start End Superfamily
1dxrH02 Alpha Beta;Alpha-Beta Complex;Photosynthetic Reaction Center; Chain H, domain 2;Photosynthetic Reaction Center, subunit H, domain 2 0.8706 92 158 3.90.50.10
1l9jH02 Alpha Beta;Alpha-Beta Complex;Photosynthetic Reaction Center; Chain H, domain 2;Photosynthetic Reaction Center, subunit H, domain 2 0.8554 93 161 3.90.50.10
af_Q9U1X0_63_325_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8521 24 55 3.50.50.60
af_Q58518_6_77_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.846 94 159 2.30.30.240
1pm3A00 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8339 94 158 2.30.30.240
ID Description Score Start End GO Terms
AF-A0A2T2QVP5-F1-model_v4 PRC-barrel domain-containing protein 0.9491 1 159
AF-A0A7T9ISX0-F1-model_v4 deleted 0.9434 1 170
AF-A0A2G6C4R0-F1-model_v4 PRC-barrel domain-containing protein 0.9402 1 170
AF-A0A4P5ULC9-F1-model_v4 PRC-barrel domain-containing protein 0.9364 1 170
AF-A0A7V1DTN6-F1-model_v4 PRC-barrel domain-containing protein 0.9341 94 159

Feature Viewer

pLDDT pTM Quality
89 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map