F227803

General Info

Members Datasets Scaffolds Average Seq Length
157 56 156 266

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0312334|Ga0395900_0312334_41_871
Length 276
Sequence VKVVVMRRLVVVLLSVVSLVLAVPVAATGETAPRLPNSMAAIGDSMTQAADVCCWYGDHPANSWSTGYAGWDGITSHYERIRAVNPTITGRNYNDSVSGARMSSAATQAGRAVAQGADYVTILMGANDLCTSSLESMTPVEVFRSQFQQALTTLDSGLKRRAHVFVSSIPDVHQLWDIYHTDLTAQFVWGVANICQSLLSPSRTDAQRDQVRQRNIAFNAVLKDECGKYAWCTFDGNAVFGYQFSRSDVSKLDYFHPSLSGQAKLANITWSTSWWA

Samples

Sample ID Description Type Environment
1 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
4 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
5 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
6 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
10 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
11 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
12 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
13 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
14 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
20 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
21 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
25 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
26 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
27 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
28 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
29 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
30 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
31 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
32 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
33 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
34 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
35 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
36 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
37 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
38 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
39 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
40 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
41 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
42 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
43 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
44 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
45 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
46 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
47 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
48 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
49 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
50 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
51 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
52 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
53 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
54 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
55 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
56 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 0.64
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.27
Rhizosphere 98.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10025184 3300003373 Bacteria 1543
2 JGI25407J50210_10045093 3300003373 Bacteria 1124
3 Ga0070698_100009371 3300005471 Bacteria 10500
4 Ga0070699_100213188 3300005518 Unclassified 1720
5 Ga0070684_100805840 3300005535 Bacteria 878
6 Ga0081455_10010381 3300005937 Bacteria 9461
7 Ga0081538_10003274 3300005981 Bacteria 15373
8 Ga0081538_10011209 3300005981 Bacteria 7281
9 Ga0081538_10032163 3300005981 Bacteria 3523
10 Ga0081538_10034442 3300005981 Bacteria 3348
11 Ga0081538_10044391 3300005981 Bacteria 2773
12 Ga0081538_10053866 3300005981 Bacteria 2387
13 Ga0081539_10001166 3300005985 Bacteria 47581
14 Ga0081539_10053470 3300005985 Bacteria 2261
15 Ga0081539_10081110 3300005985 Bacteria 1705
16 Ga0070712_100005906 3300006175 Bacteria 7575
17 Ga0075428_100065554 3300006844 Bacteria 3977
18 Ga0075431_100015764 3300006847 Bacteria 7663
19 Ga0075431_100219350 3300006847 Unclassified 1940
20 Ga0075434_100150625 3300006871 Bacteria 2346
21 Ga0075429_100032648 3300006880 Bacteria 4524
22 Ga0075429_100041521 3300006880 Bacteria 4006
23 Ga0075429_100326872 3300006880 Bacteria 1342
24 Ga0111539_10514233 3300009094 Bacteria 1395
25 Ga0105245_10141166 3300009098 Bacteria 2269
26 Ga0114129_10042349 3300009147 Bacteria 6412
27 Ga0114129_10063513 3300009147 Bacteria 5156
28 Ga0114129_10151080 3300009147 Bacteria 3178
29 Ga0105243_10052808 3300009148 Bacteria 3221
30 Ga0105242_10107879 3300009176 Bacteria 2369
31 Ga0157380_10104831 3300014326 Bacteria 2363
32 Ga0182008_10026478 3300014497 Bacteria 2941
33 Ga0206356_10926306 3300020070 Unclassified 898
34 Ga0207663_10183920 3300025916 Bacteria 1495
35 Ga0207661_10316696 3300025944 Bacteria 1402
36 Ga0307408_100183356 3300031548 Bacteria 1680
37 Ga0307408_100310489 3300031548 Bacteria 1325
38 Ga0307408_100435532 3300031548 Bacteria 1134
39 Ga0307405_10007188 3300031731 Bacteria 5545
40 Ga0307405_10043865 3300031731 Bacteria 2731
41 Ga0307405_10051242 3300031731 Unclassified 2560
42 Ga0307405_10075936 3300031731 Bacteria 2178
43 Ga0307405_10092392 3300031731 Bacteria 2007
44 Ga0307405_10097616 3300031731 Bacteria 1962
45 Ga0307413_10052901 3300031824 Bacteria 2455
46 Ga0307413_10152765 3300031824 Bacteria 1611
47 Ga0307410_10029444 3300031852 Bacteria 3496
48 Ga0307410_10079220 3300031852 Bacteria 2301
49 Ga0307410_10081767 3300031852 Unclassified 2270
50 Ga0307410_10160983 3300031852 Unclassified 1681
51 Ga0307410_10176117 3300031852 Bacteria 1616
52 Ga0307410_10200521 3300031852 Bacteria 1523
53 Ga0307410_10444089 3300031852 Unclassified 1057
54 Ga0307406_10003900 3300031901 Bacteria 8114
55 Ga0307406_10344510 3300031901 Bacteria 1162
56 Ga0307406_10497715 3300031901 Bacteria 987
57 Ga0307407_10007305 3300031903 Bacteria 4994
58 Ga0307407_10012063 3300031903 Bacteria 4141
59 Ga0307407_10042053 3300031903 Bacteria 2559
60 Ga0307407_10047766 3300031903 Unclassified 2432
61 Ga0307407_10070521 3300031903 Bacteria 2078
62 Ga0307407_10141074 3300031903 Bacteria 1554
63 Ga0307407_10194834 3300031903 Bacteria 1353
64 Ga0307412_10168481 3300031911 Bacteria 1635
65 Ga0307409_100009781 3300031995 Bacteria 5915
66 Ga0307409_100011672 3300031995 Bacteria 5553
67 Ga0307409_100053618 3300031995 Bacteria 3100
68 Ga0307409_100053723 3300031995 Bacteria 3097
69 Ga0307409_100056562 3300031995 Bacteria 3034
70 Ga0307409_100093759 3300031995 Bacteria 2468
71 Ga0307409_100168131 3300031995 Bacteria 1927
72 Ga0307409_100260468 3300031995 Unclassified 1591
73 Ga0307409_100477980 3300031995 Bacteria 1208
74 Ga0307416_100007924 3300032002 Bacteria 6802
75 Ga0307416_100008859 3300032002 Bacteria 6532
76 Ga0307416_100008942 3300032002 Bacteria 6512
77 Ga0307416_100023969 3300032002 Bacteria 4442
78 Ga0307416_100025586 3300032002 Bacteria 4329
79 Ga0307416_100051061 3300032002 Bacteria 3300
80 Ga0307416_100070252 3300032002 Bacteria 2902
81 Ga0307416_100124965 3300032002 Unclassified 2302
82 Ga0307416_100130735 3300032002 Bacteria 2259
83 Ga0307416_100132758 3300032002 Bacteria 2245
84 Ga0307416_100150122 3300032002 Bacteria 2136
85 Ga0307416_100223147 3300032002 Bacteria 1809
86 Ga0307416_100321805 3300032002 Bacteria 1549
87 Ga0307416_100436236 3300032002 Bacteria 1358
88 Ga0307416_100861310 3300032002 Bacteria 1004
89 Ga0307414_10099676 3300032004 Bacteria 2183
90 Ga0307414_10152263 3300032004 Bacteria 1826
91 Ga0307411_10030381 3300032005 Bacteria 3311
92 Ga0307411_10364033 3300032005 Bacteria 1184
93 Ga0307415_100000647 3300032126 Bacteria 15318
94 Ga0307415_100017249 3300032126 Bacteria 4324
95 Ga0307415_100019789 3300032126 Bacteria 4094
96 Ga0307415_100023183 3300032126 Bacteria 3848
97 Ga0307415_100035887 3300032126 Bacteria 3242
98 Ga0307415_100071189 3300032126 Bacteria 2444
99 Ga0307415_100099043 3300032126 Bacteria 2132
100 Ga0307415_100122060 3300032126 Bacteria 1955
101 Ga0307415_100122540 3300032126 Bacteria 1952
102 Ga0307415_100127018 3300032126 Bacteria 1923
103 Ga0307415_100147601 3300032126 Bacteria 1805
104 Ga0307415_100153849 3300032126 Bacteria 1773
105 Ga0307415_100160571 3300032126 Bacteria 1741
106 Ga0307415_100191043 3300032126 Bacteria 1616
107 Ga0307415_100283545 3300032126 Bacteria 1363
108 Ga0307415_100451338 3300032126 Bacteria 1111
109 Ga0395899_0065974 3300037312 Bacteria 2659
110 Ga0395899_0294601 3300037312 Bacteria 1100
111 Ga0395900_0020513 3300037418 Bacteria 6747
112 Ga0395900_0206660 3300037418 Bacteria 1984
113 Ga0395900_0278171 3300037418 Bacteria 1667
114 Ga0395900_0312334 3300037418 Bacteria 1555
115 Ga0395900_0540654 3300037418 Bacteria 1111
116 Ga0395900_0635357 3300037418 Unclassified 1005
117 Ga0395898_0057525 3300037466 Bacteria 3789
118 Ga0395898_0148747 3300037466 Bacteria 2241
119 Ga0395898_0166180 3300037466 Bacteria 2110
120 Ga0395898_0189797 3300037466 Bacteria 1963
121 Ga0395898_0501542 3300037466 Unclassified 1154
122 Ga0395905_0030799 3300037471 Bacteria 5052
123 Ga0395905_0040505 3300037471 Bacteria 4370
124 Ga0395905_0041469 3300037471 Bacteria 4319
125 Ga0395905_0067426 3300037471 Bacteria 3352
126 Ga0395905_0598126 3300037471 Bacteria 1005
127 Ga0395901_0020715 3300038443 Bacteria 6731
128 Ga0395901_0032348 3300038443 Bacteria 5397
129 Ga0395901_0039366 3300038443 Bacteria 4891
130 Ga0395901_0041178 3300038443 Bacteria 4786
131 Ga0395901_0041910 3300038443 Bacteria 4745
132 Ga0395901_0054477 3300038443 Bacteria 4157
133 Ga0395901_0150919 3300038443 Bacteria 2442
134 Ga0395901_0278573 3300038443 Bacteria 1738
135 Ga0395901_0285269 3300038443 Bacteria 1715
136 Ga0395901_0409619 3300038443 Bacteria 1392
137 Ga0395901_0448340 3300038443 Bacteria 1320
138 Ga0395901_0469989 3300038443 Bacteria 1284
139 Ga0395901_0753764 3300038443 Unclassified 966
140 Ga0439450_018008 3300042008 Bacteria 1479
141 Ga0439454_010948 3300042011 Unclassified 1203
142 Ga0439456_016028 3300042013 Unclassified 1567
143 Ga0439463_003622 3300042016 Bacteria 3895
144 Ga0439463_017726 3300042016 Bacteria 1768
145 Ga0450912_000346 3300042116 Unclassified 2176
146 Ga0439458_0026702 3300042157 Bacteria 1359
147 Ga0439464_0006159 3300042439 Bacteria 3119
148 Ga0496111_0031625 3300048914 Bacteria 3771
149 Ga0496113_0474531 3300048916 Bacteria 1005
150 Ga0501033_0059434 3300049570 Unclassified 2823
151 Ga0501040_0052511 3300049576 Bacteria 2790
152 Ga0501045_0525434 3300049824 Unclassified 878
153 nmdc:mga05p37_98179_c1 3300050507 Unclassified 3608
154 nmdc:mga0qj67_679445_c1 3300050509 Bacteria 820
155 nmdc:mga08y16_63906_c1 3300050511 Bacteria 3844
156 nmdc:mga0n895_105851_c1 3300050512 Bacteria 2826

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0540654 Ga0395900_0540654_13_774 216
2 3300050509 nmdc:mga0qj67_679445_c1 nmdc:mga0qj67_679445_c1_121_798 218
3 3300005981 Ga0081538_10011209 Ga0081538_100112094 220
4 3300005535 Ga0070684_100805840 Ga0070684_1008058401 224
5 3300048916 Ga0496113_0474531 Ga0496113_0474531_11_706 224
6 3300037312 Ga0395899_0294601 Ga0395899_0294601_108_911 230
7 3300038443 Ga0395901_0054477 Ga0395901_0054477_2976_3779 230
8 3300032002 Ga0307416_100150122 Ga0307416_1001501222 231
9 3300014497 Ga0182008_10026478 Ga0182008_100264784 233
10 3300038443 Ga0395901_0150919 Ga0395901_0150919_1523_2245 233
11 3300049824 Ga0501045_0525434 Ga0501045_0525434_12_740 233
12 3300042016 Ga0439463_003622 Ga0439463_003622_2331_3143 237
13 3300042157 Ga0439458_0026702 Ga0439458_0026702_532_1344 237
14 3300006844 Ga0075428_100065554 Ga0075428_1000655545 239
15 3300006880 Ga0075429_100041521 Ga0075429_1000415211 240
16 3300009147 Ga0114129_10042349 Ga0114129_100423491 240
17 3300009176 Ga0105242_10107879 Ga0105242_101078791 241
18 3300014326 Ga0157380_10104831 Ga0157380_101048311 241
19 3300032126 Ga0307415_100191043 Ga0307415_1001910433 244
20 3300009098 Ga0105245_10141166 Ga0105245_101411662 245
21 3300038443 Ga0395901_0469989 Ga0395901_0469989_431_1249 246
22 3300005471 Ga0070698_100009371 Ga0070698_1000093719 248
23 3300005937 Ga0081455_10010381 Ga0081455_100103813 248
24 3300006847 Ga0075431_100015764 Ga0075431_1000157642 248
25 3300006880 Ga0075429_100326872 Ga0075429_1003268722 248
26 3300037418 Ga0395900_0206660 Ga0395900_0206660_790_1593 248
27 3300037466 Ga0395898_0166180 Ga0395898_0166180_793_1596 248
28 3300038443 Ga0395901_0041910 Ga0395901_0041910_3154_3957 248
29 3300009148 Ga0105243_10052808 Ga0105243_100528082 250
30 3300037418 Ga0395900_0635357 Ga0395900_0635357_69_890 252
31 3300049570 Ga0501033_0059434 Ga0501033_0059434_1654_2541 252
32 3300049576 Ga0501040_0052511 Ga0501040_0052511_291_1115 252
33 3300005518 Ga0070699_100213188 Ga0070699_1002131881 253
34 3300038443 Ga0395901_0020715 Ga0395901_0020715_5709_6545 253
35 3300037418 Ga0395900_0020513 Ga0395900_0020513_1843_2661 254
36 3300037466 Ga0395898_0148747 Ga0395898_0148747_1023_1841 254
37 3300037471 Ga0395905_0040505 Ga0395905_0040505_472_1293 254
38 3300037471 Ga0395905_0041469 Ga0395905_0041469_819_1637 254
39 3300038443 Ga0395901_0039366 Ga0395901_0039366_2699_3517 254
40 3300038443 Ga0395901_0285269 Ga0395901_0285269_116_934 256
41 3300038443 Ga0395901_0448340 Ga0395901_0448340_245_1066 256
42 3300031903 Ga0307407_10012063 Ga0307407_100120633 259
43 3300031995 Ga0307409_100053723 Ga0307409_1000537232 259
44 3300032004 Ga0307414_10099676 Ga0307414_100996762 259
45 iso_pu_bacteria 2919446982 2919448102 259
46 3300037466 Ga0395898_0501542 Ga0395898_0501542_315_1127 260
47 3300006175 Ga0070712_100005906 Ga0070712_1000059067 261
48 3300025916 Ga0207663_10183920 Ga0207663_101839201 261
49 3300037466 Ga0395898_0189797 Ga0395898_0189797_70_885 261
50 3300037471 Ga0395905_0030799 Ga0395905_0030799_4045_4860 261
51 3300038443 Ga0395901_0032348 Ga0395901_0032348_3060_3875 261
52 3300025944 Ga0207661_10316696 Ga0207661_103166962 262
53 3300037418 Ga0395900_0278171 Ga0395900_0278171_422_1231 262
54 3300038443 Ga0395901_0753764 Ga0395901_0753764_16_825 262
55 3300005985 Ga0081539_10081110 Ga0081539_100811102 263
56 3300020070 Ga0206356_10926306 Ga0206356_109263061 263
57 3300037312 Ga0395899_0065974 Ga0395899_0065974_186_1007 263
58 3300037466 Ga0395898_0057525 Ga0395898_0057525_1691_2512 263
59 3300037471 Ga0395905_0067426 Ga0395905_0067426_771_1592 263
60 3300038443 Ga0395901_0041178 Ga0395901_0041178_2147_2968 263
61 3300038443 Ga0395901_0278573 Ga0395901_0278573_113_925 263
62 3300031548 Ga0307408_100183356 Ga0307408_1001833561 264
63 3300031911 Ga0307412_10168481 Ga0307412_101684811 264
64 3300031995 Ga0307409_100260468 Ga0307409_1002604681 264
65 3300032126 Ga0307415_100153849 Ga0307415_1001538492 264
66 3300037418 Ga0395900_0312334 Ga0395900_0312334_41_871 264
67 3300038443 Ga0395901_0409619 Ga0395901_0409619_529_1344 264
68 3300048914 Ga0496111_0031625 Ga0496111_0031625_1530_2348 264
69 3300005985 Ga0081539_10053470 Ga0081539_100534702 265
70 3300031731 Ga0307405_10051242 Ga0307405_100512422 265
71 3300031852 Ga0307410_10081767 Ga0307410_100817672 265
72 3300031852 Ga0307410_10444089 Ga0307410_104440891 265
73 3300032002 Ga0307416_100124965 Ga0307416_1001249652 265
74 3300032126 Ga0307415_100283545 Ga0307415_1002835451 265
75 3300042011 Ga0439454_010948 Ga0439454_010948_72_887 265
76 3300042013 Ga0439456_016028 Ga0439456_016028_534_1349 265
77 3300042439 Ga0439464_0006159 Ga0439464_0006159_2204_3019 265
78 3300003373 JGI25407J50210_10025184 JGI25407J50210_100251841 266
79 3300003373 JGI25407J50210_10045093 JGI25407J50210_100450931 266
80 3300005981 Ga0081538_10003274 Ga0081538_1000327419 266
81 3300005981 Ga0081538_10032163 Ga0081538_100321632 266
82 3300005981 Ga0081538_10034442 Ga0081538_100344423 266
83 3300005981 Ga0081538_10044391 Ga0081538_100443912 266
84 3300005981 Ga0081538_10053866 Ga0081538_100538663 266
85 3300005985 Ga0081539_10001166 Ga0081539_1000116622 266
86 3300006847 Ga0075431_100219350 Ga0075431_1002193501 266
87 3300006871 Ga0075434_100150625 Ga0075434_1001506254 266
88 3300006880 Ga0075429_100032648 Ga0075429_1000326485 266
89 3300009094 Ga0111539_10514233 Ga0111539_105142331 266
90 3300009147 Ga0114129_10063513 Ga0114129_100635134 266
91 3300009147 Ga0114129_10151080 Ga0114129_101510804 266
92 3300031548 Ga0307408_100310489 Ga0307408_1003104891 266
93 3300031548 Ga0307408_100435532 Ga0307408_1004355321 266
94 3300031731 Ga0307405_10007188 Ga0307405_100071888 266
95 3300031731 Ga0307405_10043865 Ga0307405_100438652 266
96 3300031731 Ga0307405_10075936 Ga0307405_100759363 266
97 3300031731 Ga0307405_10092392 Ga0307405_100923921 266
98 3300031731 Ga0307405_10097616 Ga0307405_100976163 266
99 3300031824 Ga0307413_10052901 Ga0307413_100529011 266
100 3300031824 Ga0307413_10152765 Ga0307413_101527652 266
101 3300031852 Ga0307410_10029444 Ga0307410_100294443 266
102 3300031852 Ga0307410_10079220 Ga0307410_100792202 266
103 3300031852 Ga0307410_10160983 Ga0307410_101609832 266
104 3300031852 Ga0307410_10176117 Ga0307410_101761172 266
105 3300031852 Ga0307410_10200521 Ga0307410_102005211 266
106 3300031901 Ga0307406_10003900 Ga0307406_100039003 266
107 3300031901 Ga0307406_10344510 Ga0307406_103445101 266
108 3300031901 Ga0307406_10497715 Ga0307406_104977151 266
109 3300031903 Ga0307407_10007305 Ga0307407_100073053 266
110 3300031903 Ga0307407_10042053 Ga0307407_100420533 266
111 3300031903 Ga0307407_10047766 Ga0307407_100477662 266
112 3300031903 Ga0307407_10070521 Ga0307407_100705212 266
113 3300031903 Ga0307407_10141074 Ga0307407_101410742 266
114 3300031903 Ga0307407_10194834 Ga0307407_101948342 266
115 3300031995 Ga0307409_100009781 Ga0307409_1000097811 266
116 3300031995 Ga0307409_100011672 Ga0307409_1000116723 266
117 3300031995 Ga0307409_100053618 Ga0307409_1000536183 266
118 3300031995 Ga0307409_100056562 Ga0307409_1000565623 266
119 3300031995 Ga0307409_100093759 Ga0307409_1000937592 266
120 3300031995 Ga0307409_100168131 Ga0307409_1001681312 266
121 3300031995 Ga0307409_100477980 Ga0307409_1004779802 266
122 3300032002 Ga0307416_100007924 Ga0307416_1000079248 266
123 3300032002 Ga0307416_100008859 Ga0307416_1000088592 266
124 3300032002 Ga0307416_100008942 Ga0307416_1000089424 266
125 3300032002 Ga0307416_100023969 Ga0307416_1000239694 266
126 3300032002 Ga0307416_100025586 Ga0307416_1000255863 266
127 3300032002 Ga0307416_100051061 Ga0307416_1000510614 266
128 3300032002 Ga0307416_100070252 Ga0307416_1000702523 266
129 3300032002 Ga0307416_100130735 Ga0307416_1001307352 266
130 3300032002 Ga0307416_100132758 Ga0307416_1001327582 266
131 3300032002 Ga0307416_100223147 Ga0307416_1002231472 266
132 3300032002 Ga0307416_100321805 Ga0307416_1003218052 266
133 3300032002 Ga0307416_100436236 Ga0307416_1004362362 266
134 3300032002 Ga0307416_100861310 Ga0307416_1008613101 266
135 3300032004 Ga0307414_10152263 Ga0307414_101522631 266
136 3300032005 Ga0307411_10030381 Ga0307411_100303811 266
137 3300032005 Ga0307411_10364033 Ga0307411_103640331 266
138 3300032126 Ga0307415_100000647 Ga0307415_1000006479 266
139 3300032126 Ga0307415_100017249 Ga0307415_1000172492 266
140 3300032126 Ga0307415_100019789 Ga0307415_1000197894 266
141 3300032126 Ga0307415_100023183 Ga0307415_1000231833 266
142 3300032126 Ga0307415_100035887 Ga0307415_1000358872 266
143 3300032126 Ga0307415_100071189 Ga0307415_1000711892 266
144 3300032126 Ga0307415_100099043 Ga0307415_1000990431 266
145 3300032126 Ga0307415_100122060 Ga0307415_1001220602 266
146 3300032126 Ga0307415_100122540 Ga0307415_1001225401 266
147 3300032126 Ga0307415_100127018 Ga0307415_1001270182 266
148 3300032126 Ga0307415_100147601 Ga0307415_1001476011 266
149 3300032126 Ga0307415_100160571 Ga0307415_1001605711 266
150 3300032126 Ga0307415_100451338 Ga0307415_1004513382 266
151 3300037471 Ga0395905_0598126 Ga0395905_0598126_46_864 266
152 3300042008 Ga0439450_018008 Ga0439450_018008_564_1382 266
153 3300042016 Ga0439463_017726 Ga0439463_017726_595_1413 266
154 3300042116 Ga0450912_000346 Ga0450912_000346_976_1794 266
155 3300050507 nmdc:mga05p37_98179_c1 nmdc:mga05p37_98179_c1_992_1810 266
156 3300050511 nmdc:mga08y16_63906_c1 nmdc:mga08y16_63906_c1_1413_2231 266
157 3300050512 nmdc:mga0n895_105851_c1 nmdc:mga0n895_105851_c1_1762_2580 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00657

Lipase_GDSL

GDSL-like Lipase/Acylhydrolase

39

269

0.79

PF13472

Lipase_GDSL_2

GDSL-like Lipase/Acylhydrolase family

41

264

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k9s-assembly1.cif.gz_A peptidoglycan o-acetylesterase in action, setmet 0.6766 93 257
5b5s-assembly1.cif.gz_A crystal structure of a carbohydrate esterase family 3 from talaromyces cellulolyticus 0.6692 85 256
7pzg-assembly1.cif.gz_AAA phocaeicola vulgatus sialic acid esterase at 1.44 angstrom resolution 0.6657 93 259
1bwq-assembly1.cif.gz_A-2 probing the substrate specificity of the intracellular brain platelet-activating factor acetylhydrolase 0.6634 112 255
7pzh-assembly4.cif.gz_GGG phocaeicola vulgatus sialic acid esterase at 2.06 angstrom resolution 0.6596 93 256
ID Description Score Start End Superfamily
af_K7DYE2_315_621_3.40.50.1110 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7427 32 257 3.40.50.1110
1yzfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7238 106 256 3.40.50.1110
af_E7EXS7_69_372_3.40.50.1110 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7164 32 257 3.40.50.1110
af_Q4D5N4_240_534_3.40.50.1110 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7116 31 257 3.40.50.1110
af_Q6P1J6_1074_1374_3.40.50.1110 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7063 22 257 3.40.50.1110
ID Description Score Start End GO Terms
AF-L8TKL0-F1-model_v4 Uncharacterized protein 0.9876 132 257
AF-A0A7X6H8W7-F1-model_v4 deleted 0.9757 108 257
AF-A0A7W0S9A9-F1-model_v4 SGNH hydrolase-type esterase domain-containing protein 0.9499 95 257 GO:0016788
AF-A0A6B1KHM1-F1-model_v4 SGNH/GDSL hydrolase family protein 0.9424 120 257 GO:0016788
AF-A0A238ZV90-F1-model_v4 Uncharacterized protein 0.9421 136 256

Feature Viewer

pLDDT pTM Quality
77.51 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map