F227536

General Info

Members Datasets Scaffolds Average Seq Length
157 98 156 290

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10003897|Ga0265334_100038974
Length 325
Sequence MPELPEVETVRLGLAKLLPRLIIKDVWHDWKKGFPNAPADVARFMIGASVKSVRRRAKVLIIELSSGYSLVIHLKMTGQLVFVHENQLEDSSSKIVARNKVRKNQSANSKLLTTNKLSARFGGGHPNDSLINNLPDKFTRVVLDFTDGSKLFFNDQRKFGWMRLLPTVEVPEIDFLKTVGPEPLEDDFTVDKFIERLQTRKNSPIKAVLLDQKVLAGVGNIYADESLFAAKIHPSTPVSKASRTKLVMLHGDLIAVLRLAIEKGGSTNRNYVNAEGKKGSYMSFAQIFRKEGQPCPRCGTIIEKIRVGGRGTHICPHCQKPPRKA

Samples

Sample ID Description Type Environment
1 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
58 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
61 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
62 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
66 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
67 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
78 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
79 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
80 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
83 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
87 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
88 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
89 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
90 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
93 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
94 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
95 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
96 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
97 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
98 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.82
Nodule 0
Rhizoplane 1.27
Rhizosphere 92.36
Stem 0
Stem Tuber 0
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10329213 3300003320 Unclassified 1109
2 Ga0070683_100088756 3300005329 Bacteria 2901
3 Ga0070682_100001326 3300005337 Bacteria 14002
4 Ga0070660_100068983 3300005339 Unclassified 2756
5 Ga0070660_100145594 3300005339 Bacteria 1903
6 Ga0070661_100119048 3300005344 Bacteria 1976
7 Ga0070668_100039404 3300005347 Unclassified 3614
8 Ga0070671_100000001 3300005355 Bacteria 1228151
9 Ga0070659_100487407 3300005366 Bacteria 1049
10 Ga0070714_100000277 3300005435 Bacteria 39221
11 Ga0070681_10576040 3300005458 Unclassified 1039
12 Ga0068867_100029986 3300005459 Bacteria 3923
13 Ga0070699_100284229 3300005518 Bacteria 1482
14 Ga0070679_100000332 3300005530 Bacteria 40130
15 Ga0070679_100113432 3300005530 Bacteria 2696
16 Ga0070693_100121187 3300005547 Bacteria 1622
17 Ga0068855_100015452 3300005563 Bacteria 9190
18 Ga0068855_100039704 3300005563 Bacteria 5587
19 Ga0068855_100317044 3300005563 Bacteria 1724
20 Ga0068855_100658387 3300005563 Bacteria 1124
21 Ga0068857_100010203 3300005577 Bacteria 8166
22 Ga0068857_100163045 3300005577 Bacteria 2023
23 Ga0068854_100101452 3300005578 Unclassified 2158
24 Ga0068856_100361479 3300005614 Bacteria 1470
25 Ga0068852_100000001 3300005616 Bacteria 716526
26 Ga0068863_100052196 3300005841 Bacteria 3876
27 Ga0068858_100006211 3300005842 Bacteria 11645
28 Ga0081539_10004105 3300005985 Bacteria 16612
29 Ga0075428_100701426 3300006844 Bacteria 1078
30 Ga0105240_10150844 3300009093 Bacteria 2768
31 Ga0105240_10610751 3300009093 Unclassified 1200
32 Ga0111539_10004256 3300009094 Bacteria 18748
33 Ga0114129_10213219 3300009147 Bacteria 2609
34 Ga0105243_10042601 3300009148 Unclassified 3554
35 Ga0105241_10001114 3300009174 Bacteria 20464
36 Ga0105241_10036080 3300009174 Bacteria 3720
37 Ga0105241_10071552 3300009174 Bacteria 2692
38 Ga0105241_10203420 3300009174 Bacteria 1655
39 Ga0105237_10000159 3300009545 Bacteria 95980
40 Ga0105237_10142758 3300009545 Bacteria 2389
41 Ga0105237_10400627 3300009545 Unclassified 1377
42 Ga0105237_10752663 3300009545 Bacteria 981
43 Ga0105238_10000151 3300009551 Bacteria 76390
44 Ga0105028_100567 3300009993 Bacteria 3933
45 Ga0105246_10081647 3300011119 Bacteria 2305
46 Ga0157370_10134996 3300013104 Unclassified 2300
47 Ga0157370_10186118 3300013104 Unclassified 1928
48 Ga0157369_10294919 3300013105 Bacteria 1688
49 Ga0157369_10365079 3300013105 Bacteria 1499
50 Ga0157369_10375482 3300013105 Bacteria 1476
51 Ga0157374_10035986 3300013296 Bacteria 4533
52 Ga0157374_10109084 3300013296 Bacteria 2661
53 Ga0207647_10005677 3300025904 Bacteria 9111
54 Ga0207705_10008400 3300025909 Bacteria 7539
55 Ga0207654_10086916 3300025911 Bacteria 1896
56 Ga0207654_10317332 3300025911 Bacteria 1064
57 Ga0207707_10007852 3300025912 Bacteria 9277
58 Ga0207695_10043076 3300025913 Bacteria 4814
59 Ga0207695_10267199 3300025913 Bacteria 1607
60 Ga0207695_10482727 3300025913 Unclassified 1121
61 Ga0207671_10000008 3300025914 Bacteria 798229
62 Ga0207671_10233518 3300025914 Unclassified 1443
63 Ga0207660_10057928 3300025917 Bacteria 2776
64 Ga0207660_10061775 3300025917 Bacteria 2697
65 Ga0207657_10108348 3300025919 Unclassified 2296
66 Ga0207649_10084520 3300025920 Bacteria 2063
67 Ga0207652_10002593 3300025921 Bacteria 15165
68 Ga0207694_10001155 3300025924 Bacteria 22934
69 Ga0207664_10000812 3300025929 Bacteria 21191
70 Ga0207644_10000001 3300025931 Bacteria 1243214
71 Ga0207709_10056596 3300025935 Unclassified 2427
72 Ga0207704_10202354 3300025938 Bacteria 1454
73 Ga0207667_10000278 3300025949 Bacteria 70630
74 Ga0207667_10004707 3300025949 Bacteria 16698
75 Ga0207667_10172136 3300025949 Bacteria 2225
76 Ga0207648_10199705 3300026089 Bacteria 1773
77 Ga0207674_10017896 3300026116 Bacteria 7724
78 Ga0207674_10019610 3300026116 Bacteria 7322
79 Ga0207674_10463995 3300026116 Bacteria 1224
80 Ga0207698_10000001 3300026142 Bacteria 625389
81 Ga0207698_10083764 3300026142 Bacteria 2582
82 Ga0268264_10068521 3300028381 Bacteria 2999
83 Ga0265337_1000048 3300028556 Bacteria 53749
84 Ga0265337_1002566 3300028556 Bacteria 8257
85 Ga0265337_1005928 3300028556 Bacteria 4782
86 Ga0265326_10003653 3300028558 Unclassified 5025
87 Ga0265334_10003897 3300028573 Bacteria 6723
88 Ga0265334_10019600 3300028573 Bacteria 2780
89 Ga0265318_10019292 3300028577 Bacteria 2767
90 Ga0265318_10044034 3300028577 Bacteria 1690
91 Ga0265322_10001541 3300028654 Bacteria 7418
92 Ga0265322_10002487 3300028654 Bacteria 5676
93 Ga0265336_10000020 3300028666 Bacteria 213480
94 Ga0265336_10004111 3300028666 Bacteria 5541
95 Ga0265336_10017604 3300028666 Bacteria 2325
96 Ga0265338_10000093 3300028800 Bacteria 168444
97 Ga0265338_10000268 3300028800 Bacteria 95143
98 Ga0265338_10001060 3300028800 Bacteria 45733
99 Ga0265338_10006180 3300028800 Bacteria 15354
100 Ga0265338_10010259 3300028800 Bacteria 11028
101 Ga0265338_10011212 3300028800 Bacteria 10385
102 Ga0265338_10020383 3300028800 Bacteria 6976
103 Ga0265338_10023332 3300028800 Bacteria 6365
104 Ga0265338_10058442 3300028800 Bacteria 3403
105 Ga0265338_10072749 3300028800 Unclassified 2933
106 Ga0265338_10139402 3300028800 Bacteria 1902
107 Ga0265338_10383576 3300028800 Bacteria 1005
108 Ga0265324_10006027 3300029957 Bacteria 5127
109 Ga0265324_10007563 3300029957 Bacteria 4389
110 Ga0265324_10007784 3300029957 Bacteria 4308
111 Ga0265324_10011588 3300029957 Unclassified 3357
112 Ga0265329_10001315 3300031242 Bacteria 12074
113 Ga0265339_10019732 3300031249 Bacteria 3951
114 Ga0265331_10032845 3300031250 Bacteria 2569
115 Ga0265327_10119629 3300031251 Unclassified 1249
116 Ga0265316_10012676 3300031344 Bacteria 7546
117 Ga0265316_10025979 3300031344 Bacteria 4879
118 Ga0265316_10058713 3300031344 Bacteria 2995
119 Ga0265316_10249567 3300031344 Bacteria 1303
120 Ga0265316_10263564 3300031344 Bacteria 1263
121 Ga0265313_10022937 3300031595 Bacteria 3374
122 Ga0265314_10083246 3300031711 Bacteria 2103
123 Ga0265314_10119084 3300031711 Bacteria 1665
124 Ga0395900_0005511 3300037418 Bacteria 13247
125 Ga0395900_0019902 3300037418 Bacteria 6842
126 Ga0395898_0065427 3300037466 Bacteria 3525
127 Ga0395901_0007168 3300038443 Bacteria 11250
128 Ga0400483_030014 3300039062 Bacteria 5386
129 Ga0400483_132253 3300039062 Bacteria 1558
130 Ga0495638_0000256 3300046460 Bacteria 71804
131 Ga0495635_0159154 3300046663 Bacteria 1537
132 Ga0495604_0367243 3300047317 Bacteria 953
133 Ga0495674_0111252 3300047319 Bacteria 2322
134 Ga0495680_0186625 3300047322 Bacteria 1494
135 Ga0496102_0184178 3300048905 Bacteria 1968
136 Ga0496112_0373342 3300048915 Bacteria 1368
137 Ga0496121_0004121 3300048924 Bacteria 19920
138 Ga0501034_0000187 3300049571 Bacteria 116046
139 Ga0501034_0000649 3300049571 Bacteria 53535
140 Ga0501034_0322790 3300049571 Bacteria 1477
141 Ga0501039_0107793 3300049575 Bacteria 2177
142 Ga0501068_0263676 3300049584 Bacteria 1099
143 Ga0501075_0299485 3300049591 Bacteria 1225
144 Ga0501076_0056472 3300049592 Bacteria 3116
145 Ga0501077_0189272 3300049593 Bacteria 1307
146 Ga0501079_0013333 3300049741 Bacteria 6267
147 Ga0501044_0155310 3300049823 Bacteria 2268
148 nmdc:mga05p37_216690_c1 3300050507 Bacteria 2312
149 nmdc:mga0a205_147916_c1 3300050515 Bacteria 2249
150 Ga0500643_000009 3300053087 Bacteria 444150
151 Ga0500643_000157 3300053087 Bacteria 68258
152 Ga0500614_029676 3300053123 Bacteria 1329
153 Ga0500568_0008900 3300053139 Unclassified 4802
154 Ga0500568_0012718 3300053139 Bacteria 3859
155 Ga0500616_0000005 3300053153 Bacteria 961725
156 Ga0501084_0036857 3300054114 Bacteria 4086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047317 Ga0495604_0367243 Ga0495604_0367243_17_730 225
2 3300037418 Ga0395900_0019902 Ga0395900_0019902_3660_4406 238
3 3300039062 Ga0400483_030014 Ga0400483_030014_15_809 260
4 3300049593 Ga0501077_0189272 Ga0501077_0189272_258_1109 260
5 3300005339 Ga0070660_100145594 Ga0070660_1001455942 270
6 3300006844 Ga0075428_100701426 Ga0075428_1007014261 270
7 3300009093 Ga0105240_10610751 Ga0105240_106107512 270
8 3300009147 Ga0114129_10213219 Ga0114129_102132191 270
9 3300013105 Ga0157369_10365079 Ga0157369_103650791 270
10 3300013296 Ga0157374_10109084 Ga0157374_101090842 270
11 3300025909 Ga0207705_10008400 Ga0207705_100084007 270
12 3300025913 Ga0207695_10482727 Ga0207695_104827272 270
13 3300048915 Ga0496112_0373342 Ga0496112_0373342_534_1358 270
14 3300050507 nmdc:mga05p37_216690_c1 nmdc:mga05p37_216690_c1_1404_2228 270
15 3300050515 nmdc:mga0a205_147916_c1 nmdc:mga0a205_147916_c1_1132_1956 270
16 3300026116 Ga0207674_10463995 Ga0207674_104639951 273
17 3300028800 Ga0265338_10139402 Ga0265338_101394023 273
18 3300048905 Ga0496102_0184178 Ga0496102_0184178_609_1493 273
19 3300048924 Ga0496121_0004121 Ga0496121_0004121_16218_17057 273
20 3300049575 Ga0501039_0107793 Ga0501039_0107793_634_1485 273
21 3300049584 Ga0501068_0263676 Ga0501068_0263676_75_929 273
22 3300049591 Ga0501075_0299485 Ga0501075_0299485_234_1085 273
23 3300049592 Ga0501076_0056472 Ga0501076_0056472_1987_2838 273
24 3300049741 Ga0501079_0013333 Ga0501079_0013333_2485_3336 273
25 3300053123 Ga0500614_029676 Ga0500614_029676_398_1240 273
26 3300054114 Ga0501084_0036857 Ga0501084_0036857_2470_3321 273
27 3300046663 Ga0495635_0159154 Ga0495635_0159154_378_1241 274
28 3300047319 Ga0495674_0111252 Ga0495674_0111252_1079_1942 274
29 3300047322 Ga0495680_0186625 Ga0495680_0186625_199_1062 274
30 iso_pu_bacteria 3000017691 3000019912 275
31 3300053139 Ga0500568_0012718 Ga0500568_0012718_3003_3836 276
32 3300039062 Ga0400483_132253 Ga0400483_132253_434_1279 277
33 3300049571 Ga0501034_0322790 Ga0501034_0322790_304_1179 281
34 3300009094 Ga0111539_10004256 Ga0111539_100042567 282
35 3300009148 Ga0105243_10042601 Ga0105243_100426013 283
36 3300025935 Ga0207709_10056596 Ga0207709_100565963 283
37 3300005347 Ga0070668_100039404 Ga0070668_1000394043 288
38 3300005616 Ga0068852_100000001 Ga0068852_10000000186 288
39 3300005842 Ga0068858_100006211 Ga0068858_1000062118 288
40 3300009174 Ga0105241_10001114 Ga0105241_1000111421 288
41 3300009545 Ga0105237_10000159 Ga0105237_1000015922 288
42 3300013296 Ga0157374_10035986 Ga0157374_100359865 288
43 3300025914 Ga0207671_10000008 Ga0207671_1000000885 288
44 3300026116 Ga0207674_10017896 Ga0207674_100178963 288
45 3300026142 Ga0207698_10000001 Ga0207698_1000000138 288
46 3300028381 Ga0268264_10068521 Ga0268264_100685212 288
47 3300038443 Ga0395901_0007168 Ga0395901_0007168_683_1552 288
48 3300053087 Ga0500643_000009 Ga0500643_000009_190171_191040 288
49 3300053087 Ga0500643_000157 Ga0500643_000157_63119_63988 288
50 3300005459 Ga0068867_100029986 Ga0068867_1000299862 289
51 3300005530 Ga0070679_100000332 Ga0070679_10000033236 289
52 3300025904 Ga0207647_10005677 Ga0207647_100056779 289
53 3300025921 Ga0207652_10002593 Ga0207652_100025935 289
54 3300026089 Ga0207648_10199705 Ga0207648_101997051 289
55 3300031250 Ga0265331_10032845 Ga0265331_100328451 289
56 3300049571 Ga0501034_0000187 Ga0501034_0000187_94700_95572 289
57 3300003320 rootH2_10329213 rootH2_103292132 290
58 3300005329 Ga0070683_100088756 Ga0070683_1000887562 290
59 3300005337 Ga0070682_100001326 Ga0070682_10000132610 290
60 3300005339 Ga0070660_100068983 Ga0070660_1000689832 290
61 3300005344 Ga0070661_100119048 Ga0070661_1001190482 290
62 3300005355 Ga0070671_100000001 Ga0070671_1000000011227 290
63 3300005366 Ga0070659_100487407 Ga0070659_1004874071 290
64 3300005435 Ga0070714_100000277 Ga0070714_10000027736 290
65 3300005458 Ga0070681_10576040 Ga0070681_105760401 290
66 3300005518 Ga0070699_100284229 Ga0070699_1002842293 290
67 3300005530 Ga0070679_100113432 Ga0070679_1001134324 290
68 3300005547 Ga0070693_100121187 Ga0070693_1001211873 290
69 3300005563 Ga0068855_100015452 Ga0068855_1000154524 290
70 3300005563 Ga0068855_100039704 Ga0068855_1000397045 290
71 3300005563 Ga0068855_100317044 Ga0068855_1003170442 290
72 3300005563 Ga0068855_100658387 Ga0068855_1006583871 290
73 3300005577 Ga0068857_100010203 Ga0068857_1000102035 290
74 3300005577 Ga0068857_100163045 Ga0068857_1001630452 290
75 3300005578 Ga0068854_100101452 Ga0068854_1001014522 290
76 3300005614 Ga0068856_100361479 Ga0068856_1003614791 290
77 3300005841 Ga0068863_100052196 Ga0068863_1000521963 290
78 3300005985 Ga0081539_10004105 Ga0081539_100041053 290
79 3300009093 Ga0105240_10150844 Ga0105240_101508442 290
80 3300009174 Ga0105241_10036080 Ga0105241_100360806 290
81 3300009174 Ga0105241_10071552 Ga0105241_100715521 290
82 3300009174 Ga0105241_10203420 Ga0105241_102034202 290
83 3300009545 Ga0105237_10142758 Ga0105237_101427582 290
84 3300009545 Ga0105237_10400627 Ga0105237_104006272 290
85 3300009545 Ga0105237_10752663 Ga0105237_107526632 290
86 3300009551 Ga0105238_10000151 Ga0105238_1000015111 290
87 3300009993 Ga0105028_100567 Ga0105028_1005673 290
88 3300011119 Ga0105246_10081647 Ga0105246_100816474 290
89 3300013104 Ga0157370_10134996 Ga0157370_101349964 290
90 3300013104 Ga0157370_10186118 Ga0157370_101861182 290
91 3300013105 Ga0157369_10294919 Ga0157369_102949193 290
92 3300013105 Ga0157369_10375482 Ga0157369_103754823 290
93 3300025911 Ga0207654_10086916 Ga0207654_100869162 290
94 3300025911 Ga0207654_10317332 Ga0207654_103173321 290
95 3300025912 Ga0207707_10007852 Ga0207707_100078524 290
96 3300025913 Ga0207695_10043076 Ga0207695_100430762 290
97 3300025913 Ga0207695_10267199 Ga0207695_102671991 290
98 3300025914 Ga0207671_10233518 Ga0207671_102335182 290
99 3300025917 Ga0207660_10057928 Ga0207660_100579284 290
100 3300025917 Ga0207660_10061775 Ga0207660_100617752 290
101 3300025919 Ga0207657_10108348 Ga0207657_101083481 290
102 3300025920 Ga0207649_10084520 Ga0207649_100845204 290
103 3300025924 Ga0207694_10001155 Ga0207694_100011555 290
104 3300025929 Ga0207664_10000812 Ga0207664_1000081214 290
105 3300025931 Ga0207644_10000001 Ga0207644_10000001207 290
106 3300025938 Ga0207704_10202354 Ga0207704_102023542 290
107 3300025949 Ga0207667_10000278 Ga0207667_1000027833 290
108 3300025949 Ga0207667_10004707 Ga0207667_100047072 290
109 3300025949 Ga0207667_10172136 Ga0207667_101721362 290
110 3300026116 Ga0207674_10019610 Ga0207674_100196108 290
111 3300026142 Ga0207698_10083764 Ga0207698_100837641 290
112 3300028556 Ga0265337_1000048 Ga0265337_100004812 290
113 3300028556 Ga0265337_1002566 Ga0265337_10025666 290
114 3300028556 Ga0265337_1005928 Ga0265337_10059283 290
115 3300028558 Ga0265326_10003653 Ga0265326_100036533 290
116 3300028573 Ga0265334_10003897 Ga0265334_100038974 290
117 3300028573 Ga0265334_10019600 Ga0265334_100196003 290
118 3300028577 Ga0265318_10019292 Ga0265318_100192922 290
119 3300028577 Ga0265318_10044034 Ga0265318_100440343 290
120 3300028654 Ga0265322_10001541 Ga0265322_1000154110 290
121 3300028654 Ga0265322_10002487 Ga0265322_100024878 290
122 3300028666 Ga0265336_10000020 Ga0265336_10000020246 290
123 3300028666 Ga0265336_10004111 Ga0265336_100041117 290
124 3300028666 Ga0265336_10017604 Ga0265336_100176043 290
125 3300028800 Ga0265338_10000093 Ga0265338_1000009310 290
126 3300028800 Ga0265338_10000268 Ga0265338_1000026882 290
127 3300028800 Ga0265338_10001060 Ga0265338_1000106034 290
128 3300028800 Ga0265338_10006180 Ga0265338_1000618010 290
129 3300028800 Ga0265338_10010259 Ga0265338_100102591 290
130 3300028800 Ga0265338_10011212 Ga0265338_100112129 290
131 3300028800 Ga0265338_10020383 Ga0265338_100203832 290
132 3300028800 Ga0265338_10023332 Ga0265338_100233322 290
133 3300028800 Ga0265338_10058442 Ga0265338_100584422 290
134 3300028800 Ga0265338_10072749 Ga0265338_100727492 290
135 3300028800 Ga0265338_10383576 Ga0265338_103835761 290
136 3300029957 Ga0265324_10006027 Ga0265324_100060275 290
137 3300029957 Ga0265324_10007563 Ga0265324_100075632 290
138 3300029957 Ga0265324_10007784 Ga0265324_100077846 290
139 3300029957 Ga0265324_10011588 Ga0265324_100115882 290
140 3300031242 Ga0265329_10001315 Ga0265329_100013157 290
141 3300031249 Ga0265339_10019732 Ga0265339_100197322 290
142 3300031251 Ga0265327_10119629 Ga0265327_101196292 290
143 3300031344 Ga0265316_10012676 Ga0265316_100126765 290
144 3300031344 Ga0265316_10025979 Ga0265316_100259792 290
145 3300031344 Ga0265316_10058713 Ga0265316_100587132 290
146 3300031344 Ga0265316_10249567 Ga0265316_102495671 290
147 3300031344 Ga0265316_10263564 Ga0265316_102635641 290
148 3300031595 Ga0265313_10022937 Ga0265313_100229372 290
149 3300031711 Ga0265314_10083246 Ga0265314_100832463 290
150 3300031711 Ga0265314_10119084 Ga0265314_101190842 290
151 3300037418 Ga0395900_0005511 Ga0395900_0005511_72_953 290
152 3300037466 Ga0395898_0065427 Ga0395898_0065427_2460_3341 290
153 3300046460 Ga0495638_0000256 Ga0495638_0000256_23694_24566 290
154 3300049571 Ga0501034_0000649 Ga0501034_0000649_20513_21394 290
155 3300049823 Ga0501044_0155310 Ga0501044_0155310_1300_2184 290
156 3300053139 Ga0500568_0008900 Ga0500568_0008900_1504_2388 290
157 3300053153 Ga0500616_0000005 Ga0500616_0000005_822978_823856 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

292

321

0.98

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

179

272

0.94

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

1

162

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kfv-assembly2.cif.gz_B crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna. 0.9253 2 288
1kfv-assembly2.cif.gz_B crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna. 0.922 2 288
1kfv-assembly1.cif.gz_A crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna. 0.9205 2 288
6rno-assembly1.cif.gz_A crystal structure of a complex between the llfpg protein, a thf-dna and an inhibitor 0.9192 2 288
4cis-assembly1.cif.gz_B structure of mutm in complex with carbocyclic 8-oxo-g containing dna 0.919 2 288
ID Description Score Start End Superfamily
4ojuC00 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.947 47 69 3.80.10.10
1kfvB02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9321 148 282 1.10.8.50
af_P9WNC3_146_285_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9263 148 286 1.10.8.50
1kfvB02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9248 148 282 1.10.8.50
1ee8B02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9191 146 282 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A660M9G6-F1-model_v4 Formamidopyrimidine-DNA glycosylase catalytic domain-containing protein 0.9883 1 137 GO:0003906
GO:0006284
GO:0008270
GO:0034039
AF-A0A660M9G6-F1-model_v4 Formamidopyrimidine-DNA glycosylase catalytic domain-containing protein 0.9742 1 137 GO:0003906
GO:0006284
GO:0008270
GO:0034039
AF-A0A2I0N246-F1-model_v4 Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23) (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase MutM) 0.956 1 287 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A2M7TI61-F1-model_v4 DNA-formamidopyrimidine glycosylase (EC 3.2.2.23) 0.9554 1 287 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A2M7TI61-F1-model_v4 DNA-formamidopyrimidine glycosylase (EC 3.2.2.23) 0.9519 1 287 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078

Feature Viewer

pLDDT pTM Quality
91.11 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map