F227476

General Info

Members Datasets Scaffolds Average Seq Length
157 106 314 100

Family's Representative Sequence

Representative Sequence 3300025986|Ga0207658_10217595|Ga0207658_102175952
Length 111
Sequence MKIVAVTACPTGIAHTYMAAEQLEKTGKSLGHEIKVETQGAMGIENELSAADIKNADFVIFAVDIEVEQRDRFEGRKIIEVPVADAIKNPKGVFARLAAKYGFDGTRFALL

Samples

Sample ID Description Type Environment
1 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
62 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
63 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
76 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
77 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
78 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
79 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
80 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
81 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
82 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
83 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
96 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
97 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
98 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
104 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
105 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
106 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.64
Rhizosphere 99.36
Stem 0
Stem Tuber 0
Unclassified 10.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207658_10217595 3300025986 Unclassified 1605
2 Ga0070683_100954598 3300005329 Bacteria 823
3 Ga0070669_100492454 3300005353 Bacteria 1016
4 Ga0070669_101908498 3300005353 Bacteria 519
5 Ga0070675_101500935 3300005354 Unclassified 622
6 Ga0070673_100829041 3300005364 Unclassified 855
7 Ga0070673_101629757 3300005364 Bacteria 610
8 Ga0070688_100025268 3300005365 Bacteria 3515
9 Ga0070667_100083019 3300005367 Bacteria 2744
10 Ga0070667_101036334 3300005367 Bacteria 766
11 Ga0070667_102355714 3300005367 Bacteria 501
12 Ga0070714_101661205 3300005435 Bacteria 624
13 Ga0070714_102132104 3300005435 Bacteria 546
14 Ga0070713_100258517 3300005436 Bacteria 1591
15 Ga0070713_100589988 3300005436 Bacteria 1055
16 Ga0070705_100191168 3300005440 Bacteria 1395
17 Ga0070678_100416202 3300005456 Bacteria 1170
18 Ga0070681_10138213 3300005458 Unclassified 2366
19 Ga0070679_100453428 3300005530 Unclassified 1227
20 Ga0070697_101851046 3300005536 Bacteria 540
21 Ga0070696_101256310 3300005546 Bacteria 627
22 Ga0070665_100000059 3300005548 Bacteria 224560
23 Ga0070665_100964398 3300005548 Unclassified 865
24 Ga0068864_100044321 3300005618 Bacteria 3812
25 Ga0068864_100866138 3300005618 Bacteria 891
26 Ga0068864_101139903 3300005618 Bacteria 777
27 Ga0068863_100373913 3300005841 Bacteria 1391
28 Ga0068863_102164082 3300005841 Unclassified 566
29 Ga0068858_101604383 3300005842 Unclassified 642
30 Ga0068858_102517918 3300005842 Bacteria 508
31 Ga0068862_101145945 3300005844 Bacteria 774
32 Ga0068862_102029637 3300005844 Bacteria 586
33 Ga0070717_11653243 3300006028 Bacteria 580
34 Ga0070716_100266734 3300006173 Bacteria 1174
35 Ga0097621_100654450 3300006237 Bacteria 964
36 Ga0097621_101337521 3300006237 Bacteria 677
37 Ga0068871_100636994 3300006358 Bacteria 972
38 Ga0075428_100053495 3300006844 Bacteria 4424
39 Ga0075434_100406107 3300006871 Bacteria 1383
40 Ga0075429_100253622 3300006880 Bacteria 1541
41 Ga0105240_10856920 3300009093 Bacteria 980
42 Ga0111539_10319550 3300009094 Bacteria 1807
43 Ga0114129_10532220 3300009147 Bacteria 1531
44 Ga0105248_10984330 3300009177 Bacteria 953
45 Ga0105237_10004438 3300009545 Bacteria 16252
46 Ga0105238_12147821 3300009551 Bacteria 593
47 Ga0105249_10089058 3300009553 Bacteria 2883
48 Ga0105239_10258681 3300010375 Unclassified 1956
49 Ga0157369_10000327 3300013105 Bacteria 63732
50 Ga0163162_10154387 3300013306 Bacteria 2415
51 Ga0163162_11740670 3300013306 Bacteria 712
52 Ga0157375_11140801 3300013308 Bacteria 913
53 Ga0157375_11760551 3300013308 Bacteria 734
54 Ga0157375_13802333 3300013308 Bacteria 501
55 Ga0163163_12419759 3300014325 Bacteria 583
56 Ga0157380_13152138 3300014326 Bacteria 526
57 Ga0157379_10457625 3300014968 Bacteria 1179
58 Ga0157376_10807239 3300014969 Bacteria 951
59 Ga0163161_10754327 3300017792 Bacteria 814
60 Ga0207699_10231088 3300025906 Bacteria 1267
61 Ga0207699_10711663 3300025906 Unclassified 735
62 Ga0207652_10251606 3300025921 Unclassified 1593
63 Ga0207681_10118259 3300025923 Bacteria 1940
64 Ga0207681_10579140 3300025923 Unclassified 926
65 Ga0207659_10369689 3300025926 Bacteria 1193
66 Ga0207700_10224524 3300025928 Unclassified 1594
67 Ga0207664_10642209 3300025929 Bacteria 954
68 Ga0207664_11028947 3300025929 Bacteria 738
69 Ga0207644_10279731 3300025931 Bacteria 1340
70 Ga0207670_10043394 3300025936 Bacteria 2970
71 Ga0207711_10998338 3300025941 Bacteria 776
72 Ga0207667_10735665 3300025949 Bacteria 987
73 Ga0207651_10768187 3300025960 Bacteria 853
74 Ga0207651_10907945 3300025960 Bacteria 785
75 Ga0207703_10907459 3300026035 Bacteria 844
76 Ga0207703_11587445 3300026035 Bacteria 629
77 Ga0207703_12189585 3300026035 Bacteria 529
78 Ga0207639_10308144 3300026041 Bacteria 1402
79 Ga0207641_10233450 3300026088 Bacteria 1711
80 Ga0207641_10626348 3300026088 Bacteria 1055
81 Ga0207648_11179338 3300026089 Bacteria 719
82 Ga0207676_10048382 3300026095 Bacteria 3301
83 Ga0207676_10260851 3300026095 Bacteria 1565
84 Ga0207676_10845252 3300026095 Bacteria 895
85 Ga0207676_12380444 3300026095 Bacteria 527
86 Ga0268266_10000033 3300028379 Bacteria 388374
87 Ga0268266_11739170 3300028379 Unclassified 599
88 Ga0268266_12059310 3300028379 Bacteria 544
89 Ga0265323_10000979 3300028653 Bacteria 14878
90 Ga0265330_10004989 3300031235 Bacteria 6672
91 Ga0265320_10503971 3300031240 Bacteria 535
92 Ga0265316_10014143 3300031344 Bacteria 7039
93 Ga0265316_10108048 3300031344 Bacteria 2109
94 Ga0265316_10780385 3300031344 Bacteria 671
95 Ga0307408_100166111 3300031548 Bacteria 1758
96 Ga0265342_10122913 3300031712 Bacteria 1460
97 Ga0307405_11104683 3300031731 Bacteria 682
98 Ga0373951_0002387 3300035091 Bacteria 4743
99 Ga0373925_0706122 3300037068 Bacteria 831
100 Ga0451807_0797397 3300041486 Unclassified 769
101 Ga0451577_0006738 3300042876 Bacteria 11397
102 Ga0451577_0049070 3300042876 Bacteria 3770
103 Ga0451577_0099786 3300042876 Bacteria 2594
104 Ga0451577_0143079 3300042876 Bacteria 2150
105 Ga0451577_1562344 3300042876 Bacteria 583
106 Ga0466961_0156528 3300044693 Bacteria 1421
107 Ga0453684_0135233 3300044712 Bacteria 2953
108 Ga0453684_0337942 3300044712 Bacteria 1701
109 Ga0453684_0424887 3300044712 Bacteria 1484
110 Ga0453684_1263756 3300044712 Bacteria 772
111 Ga0453684_1270263 3300044712 Bacteria 769
112 Ga0453684_1361590 3300044712 Bacteria 738
113 Ga0451576_0080488 3300045051 Bacteria 3389
114 Ga0451576_0310582 3300045051 Bacteria 1649
115 Ga0451576_0641946 3300045051 Unclassified 1115
116 Ga0451576_0761086 3300045051 Bacteria 1017
117 Ga0495639_0439520 3300046475 Unclassified 662
118 Ga0495628_0821000 3300046516 Bacteria 649
119 Ga0495630_0461013 3300046517 Bacteria 974
120 Ga0495630_0480729 3300046517 Bacteria 952
121 Ga0495652_0771447 3300046529 Bacteria 642
122 Ga0495645_0260366 3300046543 Bacteria 1149
123 Ga0495658_0166837 3300046683 Bacteria 1361
124 Ga0495581_0085396 3300047315 Bacteria 1829
125 Ga0495604_0150990 3300047317 Bacteria 1651
126 Ga0501031_0146095 3300049568 Bacteria 1545
127 Ga0501032_0085735 3300049569 Bacteria 2093
128 Ga0501033_0032741 3300049570 Bacteria 3904
129 Ga0501034_0658755 3300049571 Bacteria 948
130 Ga0501036_0345930 3300049572 Bacteria 1242
131 Ga0501038_0559091 3300049574 Bacteria 869
132 Ga0501039_0312080 3300049575 Bacteria 1236
133 Ga0501043_0327472 3300049579 Bacteria 1167
134 Ga0501046_0052352 3300049580 Bacteria 3217
135 Ga0501047_0000030 3300049581 Bacteria 217207
136 Ga0501047_0040162 3300049581 Bacteria 4526
137 Ga0501068_0143323 3300049584 Bacteria 1498
138 Ga0501070_0120416 3300049586 Bacteria 2169
139 Ga0501070_0683939 3300049586 Bacteria 812
140 Ga0501073_0002584 3300049589 Bacteria 13531
141 Ga0501073_0696150 3300049589 Bacteria 701
142 Ga0501076_0279161 3300049592 Bacteria 1368
143 Ga0501242_050761 3300049674 Bacteria 609
144 Ga0501225_0252834 3300049705 Bacteria 580
145 Ga0501080_0011558 3300049742 Bacteria 8085
146 Ga0501080_0136097 3300049742 Bacteria 2273
147 Ga0501080_0437643 3300049742 Bacteria 1173
148 Ga0501083_0031388 3300049744 Bacteria 3646
149 Ga0501083_0255053 3300049744 Bacteria 1141
150 Ga0501083_0286897 3300049744 Bacteria 1070
151 Ga0501035_0031279 3300049822 Bacteria 4847
152 Ga0501044_0010164 3300049823 Bacteria 10227
153 nmdc:mga09592_591496_c1 3300050508 Bacteria 951
154 nmdc:mga0n895_74540_c1 3300050512 Bacteria 3371
155 Ga0501084_0090566 3300054114 Bacteria 2568
156 Ga0501084_1204100 3300054114 Bacteria 635
157 Ga0530510_0496474 3300061734 Bacteria 925
158 Ga0207658_10217595
159 Ga0070683_100954598
160 Ga0070669_100492454
161 Ga0070669_101908498
162 Ga0070675_101500935
163 Ga0070673_100829041
164 Ga0070673_101629757
165 Ga0070688_100025268
166 Ga0070667_100083019
167 Ga0070667_101036334
168 Ga0070667_102355714
169 Ga0070714_101661205
170 Ga0070714_102132104
171 Ga0070713_100258517
172 Ga0070713_100589988
173 Ga0070705_100191168
174 Ga0070678_100416202
175 Ga0070681_10138213
176 Ga0070679_100453428
177 Ga0070697_101851046
178 Ga0070696_101256310
179 Ga0070665_100000059
180 Ga0070665_100964398
181 Ga0068864_100044321
182 Ga0068864_100866138
183 Ga0068864_101139903
184 Ga0068863_100373913
185 Ga0068863_102164082
186 Ga0068858_101604383
187 Ga0068858_102517918
188 Ga0068862_101145945
189 Ga0068862_102029637
190 Ga0070717_11653243
191 Ga0070716_100266734
192 Ga0097621_100654450
193 Ga0097621_101337521
194 Ga0068871_100636994
195 Ga0075428_100053495
196 Ga0075434_100406107
197 Ga0075429_100253622
198 Ga0105240_10856920
199 Ga0111539_10319550
200 Ga0114129_10532220
201 Ga0105248_10984330
202 Ga0105237_10004438
203 Ga0105238_12147821
204 Ga0105249_10089058
205 Ga0105239_10258681
206 Ga0157369_10000327
207 Ga0163162_10154387
208 Ga0163162_11740670
209 Ga0157375_11140801
210 Ga0157375_11760551
211 Ga0157375_13802333
212 Ga0163163_12419759
213 Ga0157380_13152138
214 Ga0157379_10457625
215 Ga0157376_10807239
216 Ga0163161_10754327
217 Ga0207699_10231088
218 Ga0207699_10711663
219 Ga0207652_10251606
220 Ga0207681_10118259
221 Ga0207681_10579140
222 Ga0207659_10369689
223 Ga0207700_10224524
224 Ga0207664_10642209
225 Ga0207664_11028947
226 Ga0207644_10279731
227 Ga0207670_10043394
228 Ga0207711_10998338
229 Ga0207667_10735665
230 Ga0207651_10768187
231 Ga0207651_10907945
232 Ga0207703_10907459
233 Ga0207703_11587445
234 Ga0207703_12189585
235 Ga0207639_10308144
236 Ga0207641_10233450
237 Ga0207641_10626348
238 Ga0207648_11179338
239 Ga0207676_10048382
240 Ga0207676_10260851
241 Ga0207676_10845252
242 Ga0207676_12380444
243 Ga0268266_10000033
244 Ga0268266_11739170
245 Ga0268266_12059310
246 Ga0265323_10000979
247 Ga0265330_10004989
248 Ga0265320_10503971
249 Ga0265316_10014143
250 Ga0265316_10108048
251 Ga0265316_10780385
252 Ga0307408_100166111
253 Ga0265342_10122913
254 Ga0307405_11104683
255 Ga0373951_0002387
256 Ga0373925_0706122
257 Ga0451807_0797397
258 Ga0451577_0006738
259 Ga0451577_0049070
260 Ga0451577_0099786
261 Ga0451577_0143079
262 Ga0451577_1562344
263 Ga0466961_0156528
264 Ga0453684_0135233
265 Ga0453684_0337942
266 Ga0453684_0424887
267 Ga0453684_1263756
268 Ga0453684_1270263
269 Ga0453684_1361590
270 Ga0451576_0080488
271 Ga0451576_0310582
272 Ga0451576_0641946
273 Ga0451576_0761086
274 Ga0495639_0439520
275 Ga0495628_0821000
276 Ga0495630_0461013
277 Ga0495630_0480729
278 Ga0495652_0771447
279 Ga0495645_0260366
280 Ga0495658_0166837
281 Ga0495581_0085396
282 Ga0495604_0150990
283 Ga0501031_0146095
284 Ga0501032_0085735
285 Ga0501033_0032741
286 Ga0501034_0658755
287 Ga0501036_0345930
288 Ga0501038_0559091
289 Ga0501039_0312080
290 Ga0501043_0327472
291 Ga0501046_0052352
292 Ga0501047_0000030
293 Ga0501047_0040162
294 Ga0501068_0143323
295 Ga0501070_0120416
296 Ga0501070_0683939
297 Ga0501073_0002584
298 Ga0501073_0696150
299 Ga0501076_0279161
300 Ga0501242_050761
301 Ga0501225_0252834
302 Ga0501080_0011558
303 Ga0501080_0136097
304 Ga0501080_0437643
305 Ga0501083_0031388
306 Ga0501083_0255053
307 Ga0501083_0286897
308 Ga0501035_0031279
309 Ga0501044_0010164
310 nmdc:mga09592_591496_c1
311 nmdc:mga0n895_74540_c1
312 Ga0501084_0090566
313 Ga0501084_1204100
314 Ga0530510_0496474

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02302

PTS_IIB

PTS system, Lactose/Cellobiose specific IIB subunit

4

96

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tn5-assembly1.cif.gz_B crystal structure of predicted fructose specific iib from escherichia coli 0.9454 3 98
5dle-assembly1.cif.gz_D crystal structure from a domain (thr161-f265) from fructose-specific iiabc component (pts system) from borrelia burgdorferi 0.9423 3 96
2kyr-assembly1.cif.gz_A solution structure of enzyme iib subunit of pts system from escherichia coli k12. northeast structural genomics consortium target er315/ontario center for structural proteomics target ec0544 0.9384 2 98
2r48-assembly1.cif.gz_A crystal structure of the fructose specific iib subunit of pts system from bacillus subtilis subsp. subtilis str. 168 0.9368 3 96
2m1z-assembly1.cif.gz_A solution structure of uncharacterized protein lmo0427 0.93 2 96
ID Description Score Start End Superfamily
af_P69816_1_106_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9532 1 98 3.40.50.2300
af_P20966_98_204_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.95 2 96 3.40.50.2300
af_P54745_176_284_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9458 2 96 3.40.50.2300
5dleD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9422 3 96 3.40.50.2300
2kyrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9384 2 98 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3N5ERI5-F1-model_v4 PTS fructose transporter subunit IIBC 0.9851 1 96 GO:0005886
GO:0009401
GO:0016301
GO:0022877
GO:0090563
AF-A0A090QZF4-F1-model_v4 protein-N(pi)-phosphohistidine--D-fructose phosphotransferase (EC 2.7.1.202) 0.9788 1 98 GO:0005886
GO:0009401
GO:0016301
GO:0022877
GO:0090563
AF-A0A2D5HN36-F1-model_v4 PTS fructose transporter subunit IIB 0.9771 1 98 GO:0005886
GO:0009401
GO:0016301
GO:0022877
GO:0090563
AF-A0A344UD10-F1-model_v4 protein-N(pi)-phosphohistidine--D-fructose phosphotransferase (EC 2.7.1.202) 0.9761 1 96 GO:0005886
GO:0009401
GO:0016301
GO:0022877
GO:0090563
AF-A0A2T6D9H2-F1-model_v4 PTS fructose transporter subunit IIB 0.9746 1 97 GO:0005886
GO:0009401
GO:0016301
GO:0022877
GO:0090563

Map