F227461

General Info

Members Datasets Scaffolds Average Seq Length
157 107 314 151

Family's Representative Sequence

Representative Sequence 3300025941|Ga0207711_11127717|Ga0207711_111277172
Length 185
Sequence MTVFLSGNDLKDNLSSNRARTMRVVIQRVSEASVTVNNADGLRTAGAIKAGLVVLLGISKLDTEIDAIYLSDKLLGLRVFPDEVGKMNRNVSEAGGAILVISQFTLYADCRKGRRPAFDRAAPPEQALSLYNYFVETLRRGPVPVETGIFQAMMEVHLVNQGPVTIIIDSEDRKASKQPPAVASE

Samples

Sample ID Description Type Environment
1 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
14 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
30 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
31 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
32 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
41 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
43 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
48 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
49 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
50 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
51 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
52 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
53 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
54 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
55 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
56 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
57 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
58 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
59 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
60 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
61 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
66 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
67 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
68 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
69 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
70 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
71 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
72 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
73 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
74 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
75 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
76 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
77 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
78 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
79 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
80 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
81 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
82 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
83 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
84 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
85 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
86 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
89 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
90 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
91 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
94 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
95 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
96 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
99 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
102 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
103 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
104 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
105 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
106 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
107 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 1.91
Rhizosphere 87.9
Stem 0
Stem Tuber 0
Unclassified 22.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207711_11127717 3300025941 Bacteria 725
2 Ga0070683_100026858 3300005329 Bacteria 5189
3 Ga0070670_100216540 3300005331 Bacteria 1666
4 Ga0070687_101065829 3300005343 Unclassified 589
5 Ga0070714_100059387 3300005435 Unclassified 3279
6 Ga0070711_100158599 3300005439 Unclassified 1713
7 Ga0070678_100757031 3300005456 Bacteria 879
8 Ga0070681_10616810 3300005458 Bacteria 999
9 Ga0070698_100375134 3300005471 Bacteria 1355
10 Ga0070672_100264506 3300005543 Bacteria 1451
11 Ga0070665_101397085 3300005548 Unclassified 709
12 Ga0081455_10015496 3300005937 Bacteria 7403
13 Ga0070712_100980388 3300006175 Unclassified 731
14 Ga0097621_100628483 3300006237 Bacteria 984
15 Ga0075428_100007536 3300006844 Bacteria 12063
16 Ga0075428_100196458 3300006844 Bacteria 2182
17 Ga0075428_100666566 3300006844 Bacteria 1109
18 Ga0075430_100005601 3300006846 Bacteria 10607
19 Ga0075430_100380775 3300006846 Bacteria 1164
20 Ga0075431_100070124 3300006847 Unclassified 3616
21 Ga0075431_100075033 3300006847 Bacteria 3489
22 Ga0075431_100145921 3300006847 Bacteria 2438
23 Ga0075431_100638181 3300006847 Unclassified 1046
24 Ga0075433_10329795 3300006852 Unclassified 1349
25 Ga0075429_100101601 3300006880 Bacteria 2510
26 Ga0075429_100377259 3300006880 Bacteria 1242
27 Ga0111539_10031735 3300009094 Bacteria 6418
28 Ga0111539_10722402 3300009094 Unclassified 1159
29 Ga0114129_10012077 3300009147 Bacteria 12293
30 Ga0114129_10286246 3300009147 Bacteria 2200
31 Ga0114129_13078647 3300009147 Unclassified 546
32 Ga0105241_10720679 3300009174 Unclassified 912
33 Ga0105242_10007853 3300009176 Bacteria 8211
34 Ga0105248_11656346 3300009177 Bacteria 725
35 Ga0105239_10633925 3300010375 Unclassified 1220
36 Ga0105239_11196324 3300010375 Bacteria 876
37 Ga0157369_12170546 3300013105 Bacteria 563
38 Ga0163162_10162084 3300013306 Unclassified 2358
39 Ga0157375_10795813 3300013308 Bacteria 1094
40 Ga0213873_10004961 3300021358 Bacteria 2518
41 Ga0213876_10000464 3300021384 Bacteria 32385
42 Ga0213875_10003648 3300021388 Bacteria 8699
43 Ga0213875_10014915 3300021388 Bacteria 3786
44 Ga0213875_10026271 3300021388 Bacteria 2770
45 Ga0207642_10183865 3300025899 Bacteria 1141
46 Ga0207699_10046024 3300025906 Bacteria 2549
47 Ga0207663_10324166 3300025916 Unclassified 1158
48 Ga0207650_10088207 3300025925 Bacteria 2365
49 Ga0207686_10003676 3300025934 Bacteria 8220
50 Ga0207691_10424427 3300025940 Bacteria 1133
51 Ga0207651_10268941 3300025960 Bacteria 1403
52 Ga0207683_10833548 3300026121 Bacteria 856
53 Ga0207428_10012840 3300027907 Bacteria 7345
54 Ga0268264_11211612 3300028381 Unclassified 764
55 Ga0265316_10422952 3300031344 Bacteria 958
56 Ga0307405_10048157 3300031731 Bacteria 2628
57 Ga0307410_10281056 3300031852 Bacteria 1306
58 Ga0307409_100354247 3300031995 Bacteria 1386
59 Ga0307409_100890931 3300031995 Bacteria 903
60 Ga0307416_100298673 3300032002 Bacteria 1599
61 Ga0307411_10007021 3300032005 Bacteria 5693
62 Ga0307411_11477698 3300032005 Bacteria 624
63 Ga0307415_100005647 3300032126 Bacteria 6662
64 Ga0316574_0003527 3300035398 Bacteria 8076
65 Ga0373947_0450379 3300035725 Bacteria 872
66 Ga0373937_0193644 3300036401 Bacteria 1911
67 Ga0373937_0716891 3300036401 Unclassified 947
68 Ga0316582_0015328 3300036647 Bacteria 4379
69 Ga0316582_0090349 3300036647 Unclassified 2015
70 Ga0316582_0095016 3300036647 Bacteria 1967
71 Ga0316582_0097731 3300036647 Bacteria 1941
72 Ga0316584_0180648 3300036712 Unclassified 1562
73 Ga0316584_0217493 3300036712 Unclassified 1405
74 Ga0316584_0671530 3300036712 Bacteria 713
75 Ga0316584_0824876 3300036712 Unclassified 629
76 Ga0436364_0094959 3300037853 Bacteria 6710
77 Ga0436364_0155862 3300037853 Bacteria 1337
78 Ga0436364_0407443 3300037853 Bacteria 1035
79 Ga0436364_0629717 3300037853 Bacteria 1278
80 Ga0436364_0825104 3300037853 Bacteria 8092
81 Ga0436365_0646118 3300039437 Bacteria 43530
82 Ga0436365_0687455 3300039437 Bacteria 1615
83 Ga0436365_0751650 3300039437 Bacteria 2804
84 Ga0436365_1724350 3300039437 Bacteria 1084
85 Ga0436360_1305460 3300039438 Bacteria 620
86 Ga0436363_0450080 3300039450 Unclassified 2409
87 Ga0451839_1422438 3300041496 Bacteria 2724
88 Ga0450918_056277 3300042531 Unclassified 721
89 Ga0451577_0822678 3300042876 Bacteria 838
90 Ga0453683_0059292 3300044673 Bacteria 2393
91 Ga0453683_0334244 3300044673 Unclassified 972
92 Ga0453684_0054330 3300044712 Bacteria 5218
93 Ga0453684_2040994 3300044712 Bacteria 576
94 Ga0451576_0358925 3300045051 Bacteria 1526
95 Ga0451576_0674438 3300045051 Unclassified 1086
96 Ga0451576_2045091 3300045051 Unclassified 590
97 Ga0466967_0282449 3300045976 Unclassified 1593
98 Ga0495592_0031375 3300046454 Bacteria 4016
99 Ga0495651_0246138 3300046462 Bacteria 1223
100 Ga0495580_0602760 3300046472 Unclassified 726
101 Ga0495664_0001207 3300046477 Bacteria 13502
102 Ga0495628_0038687 3300046516 Bacteria 3816
103 Ga0495628_0978574 3300046516 Unclassified 583
104 Ga0495630_0885405 3300046517 Unclassified 680
105 Ga0495652_0079388 3300046529 Bacteria 2713
106 Ga0495640_0189299 3300046533 Bacteria 1309
107 Ga0495640_0340922 3300046533 Bacteria 926
108 Ga0495645_0004118 3300046543 Bacteria 9929
109 Ga0495634_0043097 3300046642 Bacteria 3059
110 Ga0495635_0438905 3300046663 Bacteria 864
111 Ga0495646_0003605 3300046680 Bacteria 9667
112 Ga0495600_0102636 3300046809 Bacteria 1864
113 Ga0495604_0210506 3300047317 Bacteria 1344
114 Ga0495674_0007307 3300047319 Bacteria 10563
115 Ga0495674_0047490 3300047319 Bacteria 3807
116 Ga0495674_0365940 3300047319 Bacteria 1168
117 Ga0495674_0707183 3300047319 Unclassified 790
118 Ga0495675_0238996 3300047444 Bacteria 1094
119 Ga0495684_0070857 3300047471 Bacteria 2649
120 Ga0495684_0143537 3300047471 Bacteria 1789
121 Ga0495684_0656771 3300047471 Bacteria 700
122 Ga0495602_0220647 3300048088 Bacteria 1432
123 Ga0496111_0103617 3300048914 Bacteria 2093
124 Ga0496112_0857043 3300048915 Bacteria 832
125 Ga0496113_0151618 3300048916 Bacteria 1829
126 Ga0501046_0336894 3300049580 Bacteria 1097
127 Ga0501048_1251443 3300049582 Unclassified 534
128 Ga0501073_0009872 3300049589 Bacteria 7023
129 Ga0501074_0004961 3300049590 Bacteria 9538
130 Ga0501076_0127034 3300049592 Bacteria 2067
131 Ga0501079_0749031 3300049741 Unclassified 769
132 Ga0501080_0249076 3300049742 Bacteria 1620
133 Ga0501081_0600097 3300049743 Unclassified 824
134 Ga0501083_0012372 3300049744 Bacteria 5971
135 Ga0501083_0056435 3300049744 Bacteria 2631
136 nmdc:mga03683_12_c1 3300050489 Bacteria 98832
137 nmdc:mga05p37_160365_c1 3300050507 Bacteria 2747
138 nmdc:mga05p37_9672_c1 3300050507 Bacteria 11428
139 nmdc:mga09592_1421984_c1 3300050508 Unclassified 566
140 nmdc:mga09592_218136_c1 3300050508 Bacteria 1653
141 nmdc:mga0qj67_479866_c1 3300050509 Bacteria 1000
142 nmdc:mga0qj67_554444_c1 3300050509 Bacteria 922
143 nmdc:mga06r32_139444_c1 3300050510 Bacteria 2401
144 nmdc:mga06r32_424158_c1 3300050510 Bacteria 1311
145 nmdc:mga06r32_460831_c1 3300050510 Bacteria 1250
146 nmdc:mga06r32_50118_c1 3300050510 Bacteria 3994
147 nmdc:mga06r32_61776_c1 3300050510 Bacteria 3607
148 nmdc:mga08y16_5617_c1 3300050511 Bacteria 13134
149 nmdc:mga0n895_208091_c1 3300050512 Bacteria 1987
150 nmdc:mga0rr50_1426470_c1 3300050513 Bacteria 586
151 nmdc:mga0a205_328369_c1 3300050515 Unclassified 1400
152 Ga0495601_0000194 3300053077 Bacteria 32180
153 Ga0495619_0009017 3300053085 Bacteria 6294
154 Ga0501084_0020808 3300054114 Bacteria 5472
155 Ga0501084_0119165 3300054114 Bacteria 2218
156 Ga0501084_0433314 3300054114 Bacteria 1111
157 Ga0501082_0076836 3300060353 Bacteria 2879
158 Ga0207711_11127717
159 Ga0070683_100026858
160 Ga0070670_100216540
161 Ga0070687_101065829
162 Ga0070714_100059387
163 Ga0070711_100158599
164 Ga0070678_100757031
165 Ga0070681_10616810
166 Ga0070698_100375134
167 Ga0070672_100264506
168 Ga0070665_101397085
169 Ga0081455_10015496
170 Ga0070712_100980388
171 Ga0097621_100628483
172 Ga0075428_100007536
173 Ga0075428_100196458
174 Ga0075428_100666566
175 Ga0075430_100005601
176 Ga0075430_100380775
177 Ga0075431_100070124
178 Ga0075431_100075033
179 Ga0075431_100145921
180 Ga0075431_100638181
181 Ga0075433_10329795
182 Ga0075429_100101601
183 Ga0075429_100377259
184 Ga0111539_10031735
185 Ga0111539_10722402
186 Ga0114129_10012077
187 Ga0114129_10286246
188 Ga0114129_13078647
189 Ga0105241_10720679
190 Ga0105242_10007853
191 Ga0105248_11656346
192 Ga0105239_10633925
193 Ga0105239_11196324
194 Ga0157369_12170546
195 Ga0163162_10162084
196 Ga0157375_10795813
197 Ga0213873_10004961
198 Ga0213876_10000464
199 Ga0213875_10003648
200 Ga0213875_10014915
201 Ga0213875_10026271
202 Ga0207642_10183865
203 Ga0207699_10046024
204 Ga0207663_10324166
205 Ga0207650_10088207
206 Ga0207686_10003676
207 Ga0207691_10424427
208 Ga0207651_10268941
209 Ga0207683_10833548
210 Ga0207428_10012840
211 Ga0268264_11211612
212 Ga0265316_10422952
213 Ga0307405_10048157
214 Ga0307410_10281056
215 Ga0307409_100354247
216 Ga0307409_100890931
217 Ga0307416_100298673
218 Ga0307411_10007021
219 Ga0307411_11477698
220 Ga0307415_100005647
221 Ga0316574_0003527
222 Ga0373947_0450379
223 Ga0373937_0193644
224 Ga0373937_0716891
225 Ga0316582_0015328
226 Ga0316582_0090349
227 Ga0316582_0095016
228 Ga0316582_0097731
229 Ga0316584_0180648
230 Ga0316584_0217493
231 Ga0316584_0671530
232 Ga0316584_0824876
233 Ga0436364_0094959
234 Ga0436364_0155862
235 Ga0436364_0407443
236 Ga0436364_0629717
237 Ga0436364_0825104
238 Ga0436365_0646118
239 Ga0436365_0687455
240 Ga0436365_0751650
241 Ga0436365_1724350
242 Ga0436360_1305460
243 Ga0436363_0450080
244 Ga0451839_1422438
245 Ga0450918_056277
246 Ga0451577_0822678
247 Ga0453683_0059292
248 Ga0453683_0334244
249 Ga0453684_0054330
250 Ga0453684_2040994
251 Ga0451576_0358925
252 Ga0451576_0674438
253 Ga0451576_2045091
254 Ga0466967_0282449
255 Ga0495592_0031375
256 Ga0495651_0246138
257 Ga0495580_0602760
258 Ga0495664_0001207
259 Ga0495628_0038687
260 Ga0495628_0978574
261 Ga0495630_0885405
262 Ga0495652_0079388
263 Ga0495640_0189299
264 Ga0495640_0340922
265 Ga0495645_0004118
266 Ga0495634_0043097
267 Ga0495635_0438905
268 Ga0495646_0003605
269 Ga0495600_0102636
270 Ga0495604_0210506
271 Ga0495674_0007307
272 Ga0495674_0047490
273 Ga0495674_0365940
274 Ga0495674_0707183
275 Ga0495675_0238996
276 Ga0495684_0070857
277 Ga0495684_0143537
278 Ga0495684_0656771
279 Ga0495602_0220647
280 Ga0496111_0103617
281 Ga0496112_0857043
282 Ga0496113_0151618
283 Ga0501046_0336894
284 Ga0501048_1251443
285 Ga0501073_0009872
286 Ga0501074_0004961
287 Ga0501076_0127034
288 Ga0501079_0749031
289 Ga0501080_0249076
290 Ga0501081_0600097
291 Ga0501083_0012372
292 Ga0501083_0056435
293 nmdc:mga03683_12_c1
294 nmdc:mga05p37_160365_c1
295 nmdc:mga05p37_9672_c1
296 nmdc:mga09592_1421984_c1
297 nmdc:mga09592_218136_c1
298 nmdc:mga0qj67_479866_c1
299 nmdc:mga0qj67_554444_c1
300 nmdc:mga06r32_139444_c1
301 nmdc:mga06r32_424158_c1
302 nmdc:mga06r32_460831_c1
303 nmdc:mga06r32_50118_c1
304 nmdc:mga06r32_61776_c1
305 nmdc:mga08y16_5617_c1
306 nmdc:mga0n895_208091_c1
307 nmdc:mga0rr50_1426470_c1
308 nmdc:mga0a205_328369_c1
309 Ga0495601_0000194
310 Ga0495619_0009017
311 Ga0501084_0020808
312 Ga0501084_0119165
313 Ga0501084_0433314
314 Ga0501082_0076836

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

23

169

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.981 1 145
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9795 1 144
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9772 1 144
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9663 1 144
3knf-assembly2.cif.gz_D crystal structure of d-tyr-trna(tyr) deacylase from plasmodium falciparum 0.9657 1 144
ID Description Score Start End Superfamily
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9826 1 145 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.981 1 145 3.50.80.10
af_Q07648_1_150_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9805 1 145 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9772 1 144 3.50.80.10
af_Q2FXU2_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9758 1 145 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A2N9M0I0-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9987 2 145 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-X1ABL0-F1-model_v4 D-aminoacyl-tRNA deacylase 0.9961 1 121 GO:0005737
GO:0051500
AF-A0A1H5WW29-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9959 1 145 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A532EEZ6-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9958 1 145 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A534RNP9-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9957 1 145 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026

Map