F226893

General Info

Members Datasets Scaffolds Average Seq Length
157 120 314 120

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10199074|Ga0081455_101990742
Length 129
Sequence MADAEIANATGTQMITPGIDHIALAVPDLDAQVDRLTSAFGMVVEARFEGFALVADPSGLRIELSRSDDSQVHFRHLGFRADDVDGAHDSLVKAGMDNSEAPHRRDFAAMYTSFLKQRGGLEVQLVKYD

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
87 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
88 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
89 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
90 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
99 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
111 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
118 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
119 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
120 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.82
Nodule 0
Rhizoplane 2.55
Rhizosphere 90.45
Stem 0
Stem Tuber 0
Unclassified 28.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10199074 3300005937 Bacteria 1501
2 Ga0070683_100864650 3300005329 Bacteria 867
3 Ga0070683_102303087 3300005329 Bacteria 517
4 Ga0070666_10003380 3300005335 Bacteria 9673
5 Ga0070682_101469965 3300005337 Bacteria 585
6 Ga0070661_101096168 3300005344 Unclassified 663
7 Ga0070668_100570233 3300005347 Bacteria 987
8 Ga0070675_101388381 3300005354 Bacteria 648
9 Ga0070673_101414283 3300005364 Bacteria 655
10 Ga0070678_100549696 3300005456 Bacteria 1025
11 Ga0070662_100865026 3300005457 Unclassified 770
12 Ga0070681_11801018 3300005458 Unclassified 539
13 Ga0068867_100776676 3300005459 Unclassified 852
14 Ga0070679_100396089 3300005530 Bacteria 1327
15 Ga0070695_100708891 3300005545 Bacteria 799
16 Ga0070665_100430773 3300005548 Bacteria 1328
17 Ga0070665_100747340 3300005548 Bacteria 991
18 Ga0068855_100124997 3300005563 Bacteria 2941
19 Ga0068854_100647688 3300005578 Bacteria 907
20 Ga0068852_102256068 3300005616 Bacteria 566
21 Ga0068859_100410583 3300005617 Bacteria 1450
22 Ga0068859_101017033 3300005617 Bacteria 910
23 Ga0068859_102657625 3300005617 Unclassified 550
24 Ga0068861_102402059 3300005719 Unclassified 530
25 Ga0068862_100946165 3300005844 Unclassified 849
26 Ga0068862_102678374 3300005844 Bacteria 510
27 Ga0081455_10081181 3300005937 Bacteria 2656
28 Ga0075364_10495744 3300006051 Bacteria 835
29 Ga0075364_10700390 3300006051 Bacteria 691
30 Ga0075367_10694250 3300006178 Bacteria 647
31 Ga0097621_100307314 3300006237 Bacteria 1402
32 Ga0075428_100000022 3300006844 Bacteria 127690
33 Ga0075430_100671992 3300006846 Unclassified 854
34 Ga0075431_100183346 3300006847 Bacteria 2148
35 Ga0075434_100487016 3300006871 Bacteria 1254
36 Ga0075429_100353643 3300006880 Bacteria 1286
37 Ga0097620_100410560 3300006931 Bacteria 1450
38 Ga0097620_101017004 3300006931 Bacteria 910
39 Ga0097620_102657679 3300006931 Unclassified 550
40 Ga0075435_100954167 3300007076 Bacteria 748
41 Ga0111539_10056683 3300009094 Bacteria 4656
42 Ga0111539_10511028 3300009094 Bacteria 1399
43 Ga0111539_13476508 3300009094 Bacteria 506
44 Ga0105245_12522498 3300009098 Unclassified 567
45 Ga0105247_10420600 3300009101 Bacteria 957
46 Ga0105247_10868573 3300009101 Unclassified 694
47 Ga0114129_10091881 3300009147 Bacteria 4204
48 Ga0114129_11928845 3300009147 Bacteria 716
49 Ga0114129_12626430 3300009147 Unclassified 601
50 Ga0105243_10387833 3300009148 Bacteria 1294
51 Ga0105242_10449665 3300009176 Bacteria 1214
52 Ga0105242_10756843 3300009176 Bacteria 957
53 Ga0105248_10169349 3300009177 Bacteria 2462
54 Ga0105248_11893328 3300009177 Bacteria 677
55 Ga0105237_10967813 3300009545 Unclassified 858
56 Ga0105237_11970288 3300009545 Bacteria 592
57 Ga0105238_10232283 3300009551 Bacteria 1821
58 Ga0105238_10412002 3300009551 Bacteria 1345
59 Ga0105249_10258191 3300009553 Unclassified 1730
60 Ga0105249_10284985 3300009553 Bacteria 1651
61 Ga0105249_10427874 3300009553 Bacteria 1359
62 Ga0105249_12486357 3300009553 Unclassified 590
63 Ga0105239_10758656 3300010375 Bacteria 1111
64 Ga0105246_11303809 3300011119 Bacteria 673
65 Ga0105246_12430067 3300011119 Bacteria 514
66 Ga0157374_11458455 3300013296 Unclassified 707
67 Ga0163162_10422221 3300013306 Bacteria 1466
68 Ga0163162_11755016 3300013306 Bacteria 709
69 Ga0163162_11876231 3300013306 Unclassified 686
70 Ga0157372_12657810 3300013307 Unclassified 574
71 Ga0157375_10784310 3300013308 Bacteria 1102
72 Ga0157375_10880343 3300013308 Unclassified 1040
73 Ga0157380_11165620 3300014326 Bacteria 813
74 Ga0182008_10762357 3300014497 Bacteria 558
75 Ga0157379_11395232 3300014968 Unclassified 679
76 Ga0213873_10054190 3300021358 Bacteria 1070
77 Ga0213876_10038119 3300021384 Bacteria 2536
78 Ga0209026_1017094 3300025250 Unclassified 1165
79 Ga0207680_10007805 3300025903 Bacteria 5229
80 Ga0207671_11341985 3300025914 Bacteria 556
81 Ga0207660_11699136 3300025917 Bacteria 508
82 Ga0207694_10337464 3300025924 Bacteria 1246
83 Ga0207659_11006789 3300025926 Bacteria 717
84 Ga0207706_11497959 3300025933 Bacteria 550
85 Ga0207686_10911118 3300025934 Bacteria 710
86 Ga0207711_10184214 3300025941 Bacteria 1900
87 Ga0207667_10200138 3300025949 Bacteria 2049
88 Ga0207668_11022753 3300025972 Unclassified 739
89 Ga0207658_10364155 3300025986 Bacteria 1262
90 Ga0207677_10502498 3300026023 Bacteria 1048
91 Ga0207648_10509750 3300026089 Bacteria 1101
92 Ga0207648_10587777 3300026089 Bacteria 1025
93 Ga0207648_10682388 3300026089 Bacteria 951
94 Ga0207675_100062661 3300026118 Bacteria 3474
95 Ga0207683_11351067 3300026121 Bacteria 659
96 Ga0207428_10123727 3300027907 Bacteria 1982
97 Ga0268266_10609697 3300028379 Bacteria 1049
98 Ga0268266_11087484 3300028379 Bacteria 774
99 Ga0268265_10742551 3300028380 Bacteria 952
100 Ga0265338_10145512 3300028800 Unclassified 1849
101 Ga0265338_10391586 3300028800 Unclassified 992
102 Ga0265332_10051096 3300031238 Unclassified 1776
103 Ga0265325_10004200 3300031241 Bacteria 9150
104 Ga0265339_10014044 3300031249 Bacteria 4837
105 Ga0265316_10015415 3300031344 Bacteria 6684
106 Ga0265313_10001633 3300031595 Bacteria 20801
107 Ga0307415_100132931 3300032126 Bacteria 1887
108 Ga0373943_0343612 3300035170 Unclassified 854
109 Ga0373947_0056596 3300035725 Bacteria 2371
110 Ga0373937_0496886 3300036401 Bacteria 1159
111 Ga0373937_1644848 3300036401 Bacteria 589
112 Ga0373925_0205836 3300037068 Bacteria 1566
113 Ga0395905_1756274 3300037471 Bacteria 526
114 Ga0436365_0728446 3300039437 Bacteria 2535
115 Ga0436362_0161365 3300039453 Bacteria 645
116 Ga0439439_0066868 3300041406 Bacteria 959
117 Ga0451800_1256955 3300041459 Unclassified 542
118 Ga0451851_1275621 3300041507 Unclassified 577
119 Ga0451853_2282830 3300041512 Unclassified 1881
120 Ga0439433_0140296 3300041999 Unclassified 618
121 Ga0495592_0604296 3300046454 Bacteria 669
122 Ga0495639_0528854 3300046475 Unclassified 603
123 Ga0495618_0856030 3300046514 Unclassified 527
124 Ga0495652_0821047 3300046529 Unclassified 618
125 Ga0495640_0937787 3300046533 Unclassified 512
126 Ga0495667_0234100 3300046559 Bacteria 1171
127 Ga0495657_0895102 3300046675 Unclassified 505
128 Ga0495647_0227701 3300046681 Bacteria 825
129 Ga0495658_0077096 3300046683 Bacteria 1949
130 Ga0495658_1112562 3300046683 Unclassified 503
131 Ga0495613_0415504 3300046689 Bacteria 916
132 Ga0495624_0238313 3300046690 Bacteria 1101
133 Ga0495600_0534534 3300046809 Bacteria 718
134 Ga0495674_0289138 3300047319 Unclassified 1341
135 Ga0495672_0546122 3300047320 Unclassified 509
136 Ga0495676_0104893 3300047321 Bacteria 2085
137 Ga0495676_0962526 3300047321 Bacteria 546
138 Ga0495684_0540509 3300047471 Unclassified 795
139 Ga0495684_0725813 3300047471 Bacteria 656
140 Ga0496109_0802148 3300048912 Bacteria 879
141 Ga0496113_0891529 3300048916 Bacteria 704
142 Ga0496114_0731858 3300048917 Unclassified 866
143 nmdc:mga00v17_37777_c1 3300050491 Bacteria 2885
144 nmdc:mga06z11_280194_c1 3300050494 Unclassified 987
145 nmdc:mga05p37_1538266_c1 3300050507 Bacteria 660
146 nmdc:mga05p37_621472_c1 3300050507 Bacteria 1216
147 nmdc:mga09592_234915_c1 3300050508 Bacteria 1588
148 nmdc:mga09592_490917_c1 3300050508 Bacteria 1058
149 nmdc:mga0qj67_50830_c1 3300050509 Bacteria 3278
150 nmdc:mga06r32_103495_c1 3300050510 Bacteria 2796
151 nmdc:mga08y16_135010_c1 3300050511 Bacteria 2564
152 nmdc:mga08y16_974043_c1 3300050511 Unclassified 830
153 Ga0495601_0121621 3300053077 Bacteria 1696
154 Ga0495601_1053162 3300053077 Unclassified 510
155 Ga0495612_0441614 3300053078 Unclassified 594
156 Ga0495619_0097644 3300053085 Bacteria 1996
157 Ga0500595_031119 3300053119 Bacteria 1793
158 Ga0081455_10199074
159 Ga0070683_100864650
160 Ga0070683_102303087
161 Ga0070666_10003380
162 Ga0070682_101469965
163 Ga0070661_101096168
164 Ga0070668_100570233
165 Ga0070675_101388381
166 Ga0070673_101414283
167 Ga0070678_100549696
168 Ga0070662_100865026
169 Ga0070681_11801018
170 Ga0068867_100776676
171 Ga0070679_100396089
172 Ga0070695_100708891
173 Ga0070665_100430773
174 Ga0070665_100747340
175 Ga0068855_100124997
176 Ga0068854_100647688
177 Ga0068852_102256068
178 Ga0068859_100410583
179 Ga0068859_101017033
180 Ga0068859_102657625
181 Ga0068861_102402059
182 Ga0068862_100946165
183 Ga0068862_102678374
184 Ga0081455_10081181
185 Ga0075364_10495744
186 Ga0075364_10700390
187 Ga0075367_10694250
188 Ga0097621_100307314
189 Ga0075428_100000022
190 Ga0075430_100671992
191 Ga0075431_100183346
192 Ga0075434_100487016
193 Ga0075429_100353643
194 Ga0097620_100410560
195 Ga0097620_101017004
196 Ga0097620_102657679
197 Ga0075435_100954167
198 Ga0111539_10056683
199 Ga0111539_10511028
200 Ga0111539_13476508
201 Ga0105245_12522498
202 Ga0105247_10420600
203 Ga0105247_10868573
204 Ga0114129_10091881
205 Ga0114129_11928845
206 Ga0114129_12626430
207 Ga0105243_10387833
208 Ga0105242_10449665
209 Ga0105242_10756843
210 Ga0105248_10169349
211 Ga0105248_11893328
212 Ga0105237_10967813
213 Ga0105237_11970288
214 Ga0105238_10232283
215 Ga0105238_10412002
216 Ga0105249_10258191
217 Ga0105249_10284985
218 Ga0105249_10427874
219 Ga0105249_12486357
220 Ga0105239_10758656
221 Ga0105246_11303809
222 Ga0105246_12430067
223 Ga0157374_11458455
224 Ga0163162_10422221
225 Ga0163162_11755016
226 Ga0163162_11876231
227 Ga0157372_12657810
228 Ga0157375_10784310
229 Ga0157375_10880343
230 Ga0157380_11165620
231 Ga0182008_10762357
232 Ga0157379_11395232
233 Ga0213873_10054190
234 Ga0213876_10038119
235 Ga0209026_1017094
236 Ga0207680_10007805
237 Ga0207671_11341985
238 Ga0207660_11699136
239 Ga0207694_10337464
240 Ga0207659_11006789
241 Ga0207706_11497959
242 Ga0207686_10911118
243 Ga0207711_10184214
244 Ga0207667_10200138
245 Ga0207668_11022753
246 Ga0207658_10364155
247 Ga0207677_10502498
248 Ga0207648_10509750
249 Ga0207648_10587777
250 Ga0207648_10682388
251 Ga0207675_100062661
252 Ga0207683_11351067
253 Ga0207428_10123727
254 Ga0268266_10609697
255 Ga0268266_11087484
256 Ga0268265_10742551
257 Ga0265338_10145512
258 Ga0265338_10391586
259 Ga0265332_10051096
260 Ga0265325_10004200
261 Ga0265339_10014044
262 Ga0265316_10015415
263 Ga0265313_10001633
264 Ga0307415_100132931
265 Ga0373943_0343612
266 Ga0373947_0056596
267 Ga0373937_0496886
268 Ga0373937_1644848
269 Ga0373925_0205836
270 Ga0395905_1756274
271 Ga0436365_0728446
272 Ga0436362_0161365
273 Ga0439439_0066868
274 Ga0451800_1256955
275 Ga0451851_1275621
276 Ga0451853_2282830
277 Ga0439433_0140296
278 Ga0495592_0604296
279 Ga0495639_0528854
280 Ga0495618_0856030
281 Ga0495652_0821047
282 Ga0495640_0937787
283 Ga0495667_0234100
284 Ga0495657_0895102
285 Ga0495647_0227701
286 Ga0495658_0077096
287 Ga0495658_1112562
288 Ga0495613_0415504
289 Ga0495624_0238313
290 Ga0495600_0534534
291 Ga0495674_0289138
292 Ga0495672_0546122
293 Ga0495676_0104893
294 Ga0495676_0962526
295 Ga0495684_0540509
296 Ga0495684_0725813
297 Ga0496109_0802148
298 Ga0496113_0891529
299 Ga0496114_0731858
300 nmdc:mga00v17_37777_c1
301 nmdc:mga06z11_280194_c1
302 nmdc:mga05p37_1538266_c1
303 nmdc:mga05p37_621472_c1
304 nmdc:mga09592_234915_c1
305 nmdc:mga09592_490917_c1
306 nmdc:mga0qj67_50830_c1
307 nmdc:mga06r32_103495_c1
308 nmdc:mga08y16_135010_c1
309 nmdc:mga08y16_974043_c1
310 Ga0495601_0121621
311 Ga0495601_1053162
312 Ga0495612_0441614
313 Ga0495619_0097644
314 Ga0500595_031119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

18

125

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p8a-assembly1.cif.gz_A crystal structure of a hypothetical protein from staphylococcus aureus 0.8184 5 114
3p8a-assembly2.cif.gz_B crystal structure of a hypothetical protein from staphylococcus aureus 0.8183 5 114
6bu2-assembly1.cif.gz_A crystal structure of methylmalonyl-coa epimerase from mycobacterium tuberculosis 0.8083 7 118
7yvv-assembly1.cif.gz_A acmp1, r-4-hydroxymandelate synthase 0.8064 5 118
4ghe-assembly1.cif.gz_B structure of y257f variant of homoprotocatechuate 2,3-dioxygenase from b.fuscum in complex with 4-nitrocatechol at 1.60 ang resolution 0.8014 7 114
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9049 67 115 3.30.720.110
3vcxB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8438 11 56 3.30.720.120
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8413 64 118 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8328 69 118 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8239 66 116 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A1Y0IJA4-F1-model_v4 VOC domain-containing protein 0.9491 69 118
AF-A0A7I7QCV8-F1-model_v4 VOC domain-containing protein 0.9443 55 118
AF-A0A838RBA3-F1-model_v4 VOC family protein 0.9419 64 117
AF-A0A3D0ZSW0-F1-model_v4 VOC domain-containing protein 0.933 67 118
AF-Q1W4Z2-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.9195 64 116 GO:0004462
GO:0005737
GO:0019243

Map