F226727

General Info

Members Datasets Scaffolds Average Seq Length
157 95 314 223

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100072326|Ga0070707_1000723261
Length 242
Sequence MQGLTDRQQQVLHYIRQSIHDRGYPPTLREIGAHMGIRSTNGVNDHLRALERKGYLTREDMKSRALRPRDLADGEPGPHGANGGPASAMGDVDTGFGGGTPHSSPPANDHDEDLVEIPIVGRIAAGLPVLAEENVLDTVRIDRSLVRGGREVFGLRVTGDSMIEAGIYSGDYIFVRKQLTAQRGDIVVALIGDEATVKYYYPEKDYIRFQPANAAMAPILVRASDFRPTMLLGVVIGVYRKL

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
29 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
38 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
41 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
42 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
43 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
44 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
45 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
46 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
47 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
49 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
50 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
51 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
52 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
53 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
54 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
55 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
56 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
57 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
58 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
59 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
60 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
61 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
62 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
63 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
64 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
65 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
66 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
69 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
70 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
71 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
75 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
76 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
77 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
78 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
79 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
80 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
81 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
82 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
83 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
84 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
86 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
87 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
88 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
89 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
90 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
91 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
92 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
94 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
95 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.09
Metatranscriptomes 1.27
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.82
Nodule 0
Rhizoplane 3.18
Rhizosphere 89.81
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100072326 3300005468 Bacteria 3323
2 Ga0055536_1001024 3300003781 Bacteria 17654
3 Ga0055536_1007399 3300003781 Bacteria 4926
4 Ga0070683_100489418 3300005329 Bacteria 1175
5 Ga0070683_100937198 3300005329 Bacteria 831
6 Ga0070677_10020017 3300005333 Bacteria 2432
7 Ga0070682_100000293 3300005337 Bacteria 35451
8 Ga0070682_100020034 3300005337 Bacteria 3931
9 Ga0070682_100150705 3300005337 Bacteria 1595
10 Ga0070660_100750955 3300005339 Bacteria 819
11 Ga0070689_100009707 3300005340 Bacteria 6829
12 Ga0070667_100223427 3300005367 Bacteria 1677
13 Ga0070679_100885874 3300005530 Bacteria 836
14 Ga0068853_100002894 3300005539 Bacteria 13029
15 Ga0070672_100013036 3300005543 Bacteria 5859
16 Ga0070665_100158513 3300005548 Bacteria 2265
17 Ga0068855_100003237 3300005563 Bacteria 19935
18 Ga0068856_100031015 3300005614 Bacteria 5229
19 Ga0068856_100222920 3300005614 Bacteria 1901
20 Ga0068852_100052770 3300005616 Bacteria 3496
21 Ga0068851_10085184 3300005834 Bacteria 1656
22 Ga0068860_100269649 3300005843 Bacteria 1661
23 Ga0068860_100473288 3300005843 Bacteria 1248
24 Ga0075366_10090190 3300006195 Bacteria 1836
25 Ga0068871_100191243 3300006358 Bacteria 1763
26 Ga0075428_100208289 3300006844 Bacteria 2113
27 Ga0075428_101226791 3300006844 Bacteria 790
28 Ga0075430_100115659 3300006846 Bacteria 2235
29 Ga0105240_10534979 3300009093 Bacteria 1298
30 Ga0105245_10009657 3300009098 Bacteria 8413
31 Ga0105247_10002208 3300009101 Bacteria 13405
32 Ga0105241_10044876 3300009174 Bacteria 3351
33 Ga0157378_10897803 3300013297 Bacteria 917
34 Ga0163163_10720839 3300014325 Bacteria 1061
35 Ga0157376_10144388 3300014969 Bacteria 2139
36 Ga0209050_1000822 3300025298 Bacteria 43254
37 Ga0207710_10001486 3300025900 Bacteria 11620
38 Ga0207646_10090701 3300025922 Bacteria 2735
39 Ga0207670_10010720 3300025936 Bacteria 5290
40 Ga0207691_10004932 3300025940 Bacteria 12878
41 Ga0207667_10052692 3300025949 Bacteria 4284
42 Ga0207639_10001350 3300026041 Bacteria 16554
43 Ga0207702_10069658 3300026078 Bacteria 3024
44 Ga0207702_10397247 3300026078 Bacteria 1329
45 Ga0207428_10153528 3300027907 Bacteria 1752
46 Ga0268266_10121136 3300028379 Bacteria 2328
47 Ga0268264_10319131 3300028381 Bacteria 1468
48 Ga0265327_10291836 3300031251 Bacteria 719
49 Ga0307513_10187068 3300031456 Bacteria 1927
50 Ga0307513_10284291 3300031456 Bacteria 1430
51 Ga0316576_10068409 3300031727 Bacteria 2616
52 Ga0307412_10290640 3300031911 Bacteria 1287
53 Ga0307411_10480944 3300032005 Bacteria 1046
54 Ga0307415_100764501 3300032126 Bacteria 878
55 Ga0307507_10040412 3300033179 Bacteria 4686
56 Ga0316588_1115082 3300033528 Bacteria 678
57 Ga0373934_0222021 3300035086 Bacteria 779
58 Ga0373945_0281489 3300035116 Bacteria 709
59 Ga0373945_0288826 3300035116 Bacteria 700
60 Ga0373955_0243722 3300035172 Bacteria 1077
61 Ga0373931_0330154 3300035691 Bacteria 950
62 Ga0373933_0041650 3300035724 Bacteria 2712
63 Ga0373937_0065135 3300036401 Bacteria 3354
64 Ga0373925_0038060 3300037068 Bacteria 3554
65 Ga0436365_0248129 3300039437 Bacteria 1083
66 Ga0436365_0808777 3300039437 Bacteria 1868
67 Ga0436360_1052166 3300039438 Bacteria 691
68 Ga0451789_1329612 3300041443 Bacteria 1493
69 Ga0451793_1323086 3300041452 Bacteria 1140
70 Ga0451802_0047758 3300041460 Bacteria 1579
71 Ga0451807_1191766 3300041486 Bacteria 1476
72 Ga0451807_2582871 3300041486 Bacteria 9936
73 Ga0439445_0003205 3300042004 Bacteria 3669
74 Ga0439449_0036737 3300042007 Bacteria 1822
75 Ga0451577_0000119 3300042876 Bacteria 172779
76 Ga0451577_0050297 3300042876 Bacteria 3720
77 Ga0451577_0105752 3300042876 Bacteria 2515
78 Ga0451577_0106006 3300042876 Bacteria 2512
79 Ga0451577_0108675 3300042876 Bacteria 2479
80 Ga0451577_0146592 3300042876 Bacteria 2123
81 Ga0451577_0415316 3300042876 Bacteria 1221
82 Ga0451577_0445156 3300042876 Bacteria 1176
83 Ga0451577_0459991 3300042876 Bacteria 1155
84 Ga0451577_0617436 3300042876 Bacteria 983
85 Ga0453683_0000969 3300044673 Bacteria 27157
86 Ga0453683_0001197 3300044673 Bacteria 23375
87 Ga0453683_0002732 3300044673 Bacteria 13466
88 Ga0453683_0018651 3300044673 Bacteria 4454
89 Ga0453683_0031968 3300044673 Bacteria 3323
90 Ga0453683_0083943 3300044673 Bacteria 1996
91 Ga0453683_0255390 3300044673 Bacteria 1117
92 Ga0453683_0423289 3300044673 Bacteria 859
93 Ga0453684_0000258 3300044712 Bacteria 228312
94 Ga0453684_0002191 3300044712 Bacteria 48681
95 Ga0453684_0002627 3300044712 Bacteria 42939
96 Ga0453684_0002718 3300044712 Bacteria 41925
97 Ga0453684_0012633 3300044712 Bacteria 13883
98 Ga0453684_0018309 3300044712 Bacteria 10764
99 Ga0453684_0019122 3300044712 Bacteria 10452
100 Ga0453684_0062050 3300044712 Bacteria 4791
101 Ga0453684_0073896 3300044712 Bacteria 4295
102 Ga0453684_0079038 3300044712 Bacteria 4112
103 Ga0453684_0079225 3300044712 Bacteria 4107
104 Ga0453684_0097083 3300044712 Bacteria 3617
105 Ga0453684_0108238 3300044712 Bacteria 3383
106 Ga0453684_0445904 3300044712 Bacteria 1441
107 Ga0453684_1151328 3300044712 Bacteria 817
108 Ga0453684_1327503 3300044712 Bacteria 749
109 Ga0453684_1457733 3300044712 Bacteria 708
110 Ga0466957_0298551 3300044842 Bacteria 1082
111 Ga0451576_0001212 3300045051 Bacteria 46010
112 Ga0451576_0004496 3300045051 Bacteria 18051
113 Ga0451576_0028573 3300045051 Bacteria 5971
114 Ga0451576_0086546 3300045051 Bacteria 3259
115 Ga0451576_0280977 3300045051 Bacteria 1740
116 Ga0451576_0510385 3300045051 Bacteria 1263
117 Ga0451576_0526811 3300045051 Bacteria 1241
118 Ga0451576_0572657 3300045051 Bacteria 1186
119 Ga0451576_0740362 3300045051 Bacteria 1033
120 Ga0451576_0868397 3300045051 Bacteria 947
121 Ga0451576_1562428 3300045051 Bacteria 685
122 Ga0495662_0116412 3300046476 Bacteria 1311
123 Ga0495658_0022417 3300046683 Bacteria 3339
124 Ga0495680_0060564 3300047322 Bacteria 2917
125 Ga0501031_0315701 3300049568 Bacteria 1013
126 Ga0501032_0263638 3300049569 Bacteria 1117
127 Ga0501041_0091945 3300049577 Bacteria 1873
128 Ga0501071_0351160 3300049587 Bacteria 1122
129 Ga0501072_0338281 3300049588 Bacteria 1196
130 Ga0501073_0008192 3300049589 Bacteria 7753
131 Ga0501074_0476934 3300049590 Bacteria 884
132 Ga0501075_0503069 3300049591 Bacteria 924
133 Ga0501076_0339917 3300049592 Bacteria 1232
134 Ga0501079_0118299 3300049741 Bacteria 2060
135 Ga0501080_0057160 3300049742 Bacteria 3633
136 Ga0501080_0246513 3300049742 Bacteria 1629
137 Ga0501081_0091455 3300049743 Bacteria 2140
138 Ga0501083_0004550 3300049744 Bacteria 9799
139 Ga0501083_0066702 3300049744 Bacteria 2396
140 Ga0501083_0153582 3300049744 Bacteria 1507
141 Ga0501035_0418447 3300049822 Bacteria 1113
142 Ga0501045_0047974 3300049824 Bacteria 3112
143 nmdc:mga03n38_287823_c1 3300050490 Bacteria 879
144 nmdc:mga0k408_75307_c1 3300050493 Bacteria 1972
145 nmdc:mga0qj67_120150_c1 3300050509 Bacteria 2125
146 nmdc:mga08y16_126210_c1 3300050511 Bacteria 2662
147 nmdc:mga08y16_970131_c1 3300050511 Unclassified 832
148 Ga0495619_0031018 3300053085 Bacteria 3462
149 Ga0501084_0006574 3300054114 Bacteria 9552
150 Ga0501084_0203550 3300054114 Bacteria 1670
151 Ga0501084_0639646 3300054114 Bacteria 898
152 Ga0587062_037790 3300059639 Bacteria 770
153 Ga0501082_0242046 3300060353 Bacteria 1570
154 Ga0501082_0339849 3300060353 Bacteria 1308
155 Ga0501082_0660603 3300060353 Bacteria 915
156 Ga0530510_0039864 3300061734 Bacteria 3390
157 2896184939 2896184354 Bacteria 3258548
158 Ga0070707_100072326
159 Ga0055536_1001024
160 Ga0055536_1007399
161 Ga0070683_100489418
162 Ga0070683_100937198
163 Ga0070677_10020017
164 Ga0070682_100000293
165 Ga0070682_100020034
166 Ga0070682_100150705
167 Ga0070660_100750955
168 Ga0070689_100009707
169 Ga0070667_100223427
170 Ga0070679_100885874
171 Ga0068853_100002894
172 Ga0070672_100013036
173 Ga0070665_100158513
174 Ga0068855_100003237
175 Ga0068856_100031015
176 Ga0068856_100222920
177 Ga0068852_100052770
178 Ga0068851_10085184
179 Ga0068860_100269649
180 Ga0068860_100473288
181 Ga0075366_10090190
182 Ga0068871_100191243
183 Ga0075428_100208289
184 Ga0075428_101226791
185 Ga0075430_100115659
186 Ga0105240_10534979
187 Ga0105245_10009657
188 Ga0105247_10002208
189 Ga0105241_10044876
190 Ga0157378_10897803
191 Ga0163163_10720839
192 Ga0157376_10144388
193 Ga0209050_1000822
194 Ga0207710_10001486
195 Ga0207646_10090701
196 Ga0207670_10010720
197 Ga0207691_10004932
198 Ga0207667_10052692
199 Ga0207639_10001350
200 Ga0207702_10069658
201 Ga0207702_10397247
202 Ga0207428_10153528
203 Ga0268266_10121136
204 Ga0268264_10319131
205 Ga0265327_10291836
206 Ga0307513_10187068
207 Ga0307513_10284291
208 Ga0316576_10068409
209 Ga0307412_10290640
210 Ga0307411_10480944
211 Ga0307415_100764501
212 Ga0307507_10040412
213 Ga0316588_1115082
214 Ga0373934_0222021
215 Ga0373945_0281489
216 Ga0373945_0288826
217 Ga0373955_0243722
218 Ga0373931_0330154
219 Ga0373933_0041650
220 Ga0373937_0065135
221 Ga0373925_0038060
222 Ga0436365_0248129
223 Ga0436365_0808777
224 Ga0436360_1052166
225 Ga0451789_1329612
226 Ga0451793_1323086
227 Ga0451802_0047758
228 Ga0451807_1191766
229 Ga0451807_2582871
230 Ga0439445_0003205
231 Ga0439449_0036737
232 Ga0451577_0000119
233 Ga0451577_0050297
234 Ga0451577_0105752
235 Ga0451577_0106006
236 Ga0451577_0108675
237 Ga0451577_0146592
238 Ga0451577_0415316
239 Ga0451577_0445156
240 Ga0451577_0459991
241 Ga0451577_0617436
242 Ga0453683_0000969
243 Ga0453683_0001197
244 Ga0453683_0002732
245 Ga0453683_0018651
246 Ga0453683_0031968
247 Ga0453683_0083943
248 Ga0453683_0255390
249 Ga0453683_0423289
250 Ga0453684_0000258
251 Ga0453684_0002191
252 Ga0453684_0002627
253 Ga0453684_0002718
254 Ga0453684_0012633
255 Ga0453684_0018309
256 Ga0453684_0019122
257 Ga0453684_0062050
258 Ga0453684_0073896
259 Ga0453684_0079038
260 Ga0453684_0079225
261 Ga0453684_0097083
262 Ga0453684_0108238
263 Ga0453684_0445904
264 Ga0453684_1151328
265 Ga0453684_1327503
266 Ga0453684_1457733
267 Ga0466957_0298551
268 Ga0451576_0001212
269 Ga0451576_0004496
270 Ga0451576_0028573
271 Ga0451576_0086546
272 Ga0451576_0280977
273 Ga0451576_0510385
274 Ga0451576_0526811
275 Ga0451576_0572657
276 Ga0451576_0740362
277 Ga0451576_0868397
278 Ga0451576_1562428
279 Ga0495662_0116412
280 Ga0495658_0022417
281 Ga0495680_0060564
282 Ga0501031_0315701
283 Ga0501032_0263638
284 Ga0501041_0091945
285 Ga0501071_0351160
286 Ga0501072_0338281
287 Ga0501073_0008192
288 Ga0501074_0476934
289 Ga0501075_0503069
290 Ga0501076_0339917
291 Ga0501079_0118299
292 Ga0501080_0057160
293 Ga0501080_0246513
294 Ga0501081_0091455
295 Ga0501083_0004550
296 Ga0501083_0066702
297 Ga0501083_0153582
298 Ga0501035_0418447
299 Ga0501045_0047974
300 nmdc:mga03n38_287823_c1
301 nmdc:mga0k408_75307_c1
302 nmdc:mga0qj67_120150_c1
303 nmdc:mga08y16_126210_c1
304 nmdc:mga08y16_970131_c1
305 Ga0495619_0031018
306 Ga0501084_0006574
307 Ga0501084_0203550
308 Ga0501084_0639646
309 Ga0587062_037790
310 Ga0501082_0242046
311 Ga0501082_0339849
312 Ga0501082_0660603
313 Ga0530510_0039864
314 2896184939

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01726

LexA_DNA_bind

LexA DNA binding domain

1

65

0.99

PF00717

Peptidase_S24

Peptidase S24-like

118

236

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jhf-assembly1.cif.gz_B lexa g85d mutant 0.9367 139 226
1leb-assembly1.cif.gz_A solution structure of the lexa repressor dna binding determined by 1h nmr spectroscopy 0.9068 2 67
1lea-assembly1.cif.gz_A solution structure of the lexa repressor dna binding determined by 1h nmr spectroscopy 0.8951 1 68
4hx7-assembly1.cif.gz_B structure of mntr e11k mutant complexed with cd2+ 0.8907 3 55
8gmt-assembly1.cif.gz_A structure of umud in complex with reca filament 0.8875 131 224
ID Description Score Start End Superfamily
af_P9WHR7_25_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9493 2 66 1.10.10.10
1jhfB00 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.9367 139 226 2.10.109.10
3k2zB02 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.9244 118 226 2.10.109.10
3k2zB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9237 1 66 1.10.10.10
3k2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9191 1 66 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A381IAK9-F1-model_v4 SOS regulatory protein (EC 3.4.21.88) 1 148 227 GO:0003677
GO:0004252
AF-A0A532AQN7-F1-model_v4 Repressor LexA 0.9981 139 226 GO:0003677
GO:0006281
GO:0006355
GO:0009432
GO:0016787
AF-A0A381IAK9-F1-model_v4 SOS regulatory protein (EC 3.4.21.88) 0.9877 148 227 GO:0003677
GO:0004252
AF-A0A7C7D0D0-F1-model_v4 Peptidase 0.9871 141 226 GO:0003677
AF-A0A520F5R2-F1-model_v4 deleted 0.9856 103 227

Map