F225475

General Info

Members Datasets Scaffolds Average Seq Length
156 109 312 81

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0315974|Ga0466972_0315974_57_320
Length 87
Sequence MTAPTTARVTLYSRAGCHLCDEARAVVAAVCEELGESFEEVDIDAAGTDPELRERFTDEVPVTFVDGRQHDFWRVSPDRLRAALRPS

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
10 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
23 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
33 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
36 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
37 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
38 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
39 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
40 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
41 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
42 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
43 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
44 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
45 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
46 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
47 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
48 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
49 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
50 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
51 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
52 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
53 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
54 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
55 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
56 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
57 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
58 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
59 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
60 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
61 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
64 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
65 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
66 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
80 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
81 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
82 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
83 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
84 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
85 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
86 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
87 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
92 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
93 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
94 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
95 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
96 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
97 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
98 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
99 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
100 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
101 2643221576 Nocardioides sp. Root614 Isolate Unclassified
102 2643221590 Nocardioides sp. Root682 Isolate Unclassified
103 2643221604 Nocardioides sp. Root190 Isolate Unclassified
104 2738541305 Nocardioides sp. CF167 Isolate Unclassified
105 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
106 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
107 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
108 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
109 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.23
Metatranscriptomes 0
Isolates 5.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.82
Nodule 0
Rhizoplane 1.28
Rhizosphere 77.56
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0315974 3300044658 Bacteria 730
2 JGI24739J22299_10066372 3300001989 Bacteria 1130
3 Ga0070683_100207885 3300005329 Bacteria 1859
4 Ga0070660_100578574 3300005339 Bacteria 938
5 Ga0070700_101768215 3300005441 Bacteria 532
6 Ga0070678_100690278 3300005456 Bacteria 919
7 Ga0070684_100311248 3300005535 Bacteria 1446
8 Ga0068857_100531698 3300005577 Bacteria 1106
9 Ga0068854_101000919 3300005578 Bacteria 740
10 Ga0068852_101150034 3300005616 Bacteria 797
11 Ga0081539_10077905 3300005985 Bacteria 1751
12 Ga0075365_10043816 3300006038 Bacteria 2930
13 Ga0075365_10176050 3300006038 Bacteria 1494
14 Ga0075365_10328821 3300006038 Bacteria 1076
15 Ga0075363_100294538 3300006048 Bacteria 941
16 Ga0075364_10439089 3300006051 Bacteria 892
17 Ga0075364_10729964 3300006051 Bacteria 676
18 Ga0075362_10218105 3300006177 Bacteria 932
19 Ga0075370_10014226 3300006353 Bacteria 4240
20 Ga0075428_101237934 3300006844 Bacteria 786
21 Ga0111539_10228442 3300009094 Bacteria 2167
22 Ga0105243_12684845 3300009148 Bacteria 538
23 Ga0105242_12423427 3300009176 Bacteria 572
24 Ga0105248_10952803 3300009177 Bacteria 969
25 Ga0163161_10314202 3300017792 Bacteria 1237
26 Ga0207643_10192065 3300025908 Bacteria 1240
27 Ga0207661_10221981 3300025944 Bacteria 1671
28 Ga0207651_10385988 3300025960 Bacteria 1188
29 Ga0207712_11422076 3300025961 Bacteria 621
30 Ga0207668_10079776 3300025972 Bacteria 2369
31 Ga0207640_11870569 3300025981 Bacteria 543
32 Ga0207708_10144284 3300026075 Bacteria 1870
33 Ga0207698_10522120 3300026142 Bacteria 1159
34 Ga0268264_11362481 3300028381 Bacteria 720
35 Ga0314311_1066223 3300030733 Bacteria 1294
36 Ga0316181_1188129 3300030744 Bacteria 1745
37 Ga0307408_101995824 3300031548 Bacteria 558
38 Ga0307413_10032789 3300031824 Bacteria 2949
39 Ga0307410_10286471 3300031852 Bacteria 1295
40 Ga0307410_10412948 3300031852 Bacteria 1093
41 Ga0307410_10499554 3300031852 Bacteria 1001
42 Ga0307406_10924711 3300031901 Bacteria 744
43 Ga0307407_10604537 3300031903 Bacteria 817
44 Ga0307407_10901522 3300031903 Bacteria 678
45 Ga0307412_10493583 3300031911 Bacteria 1018
46 Ga0307412_11715699 3300031911 Bacteria 576
47 Ga0307409_100042155 3300031995 Bacteria 3416
48 Ga0307411_10401935 3300032005 Bacteria 1133
49 Ga0307415_100182186 3300032126 Bacteria 1649
50 Ga0395899_0535741 3300037312 Bacteria 755
51 Ga0395900_0025824 3300037418 Bacteria 6013
52 Ga0395900_0108326 3300037418 Bacteria 2854
53 Ga0395900_1683581 3300037418 Bacteria 545
54 Ga0395898_0300636 3300037466 Bacteria 1531
55 Ga0395905_0102841 3300037471 Bacteria 2682
56 Ga0395905_0379696 3300037471 Bacteria 1307
57 Ga0395901_0006072 3300038443 Bacteria 12241
58 Ga0395901_0329326 3300038443 Bacteria 1579
59 Ga0439438_111631 3300041405 Bacteria 660
60 Ga0451839_1062649 3300041496 Bacteria 500
61 Ga0451841_1425217 3300041498 Bacteria 674
62 Ga0451853_0462131 3300041512 Bacteria 562
63 Ga0439433_0196216 3300041999 Bacteria 532
64 Ga0466969_0317099 3300044656 Bacteria 706
65 Ga0466972_0599882 3300044658 Bacteria 521
66 Ga0466965_0421884 3300044683 Bacteria 740
67 Ga0466961_0047227 3300044693 Bacteria 2753
68 Ga0466963_0665296 3300044694 Bacteria 735
69 Ga0466964_0631526 3300044706 Bacteria 590
70 Ga0466970_0004651 3300044765 Bacteria 6772
71 Ga0466970_0013704 3300044765 Bacteria 4159
72 Ga0466970_0128256 3300044765 Bacteria 1392
73 Ga0466970_0205431 3300044765 Bacteria 1096
74 Ga0466970_0489121 3300044765 Bacteria 708
75 Ga0466957_0064598 3300044842 Bacteria 2252
76 Ga0466957_0075301 3300044842 Bacteria 2094
77 Ga0466957_0259518 3300044842 Bacteria 1158
78 Ga0466960_0006134 3300044901 Bacteria 4810
79 Ga0466960_0077102 3300044901 Bacteria 1671
80 Ga0466960_0140549 3300044901 Bacteria 1282
81 Ga0466960_0622225 3300044901 Bacteria 642
82 Ga0466959_0109769 3300045049 Bacteria 1970
83 Ga0466967_1012826 3300045976 Bacteria 827
84 Ga0466967_1062360 3300045976 Bacteria 806
85 Ga0466967_2555157 3300045976 Bacteria 505
86 Ga0496104_1095288 3300048907 Bacteria 700
87 Ga0496105_0420636 3300048908 Bacteria 1058
88 Ga0496117_0539136 3300048920 Bacteria 558
89 Ga0501031_0029106 3300049568 Bacteria 3603
90 Ga0501031_0131059 3300049568 Bacteria 1638
91 Ga0501031_0396195 3300049568 Bacteria 893
92 Ga0501032_0467706 3300049569 Bacteria 807
93 Ga0501032_0962334 3300049569 Bacteria 537
94 Ga0501033_0646608 3300049570 Bacteria 723
95 Ga0501034_0523941 3300049571 Bacteria 1097
96 Ga0501036_0221294 3300049572 Bacteria 1589
97 Ga0501037_0849067 3300049573 Bacteria 601
98 Ga0501038_0090087 3300049574 Bacteria 2572
99 Ga0501039_0015347 3300049575 Bacteria 5864
100 Ga0501040_0253280 3300049576 Bacteria 1256
101 Ga0501040_0493159 3300049576 Bacteria 883
102 Ga0501040_0649756 3300049576 Unclassified 762
103 Ga0501041_0639676 3300049577 Bacteria 680
104 Ga0501042_0038519 3300049578 Bacteria 3395
105 Ga0501042_0044985 3300049578 Bacteria 3146
106 Ga0501043_0627769 3300049579 Bacteria 791
107 Ga0501048_0091467 3300049582 Bacteria 2146
108 Ga0501067_0396399 3300049583 Bacteria 770
109 Ga0501069_0055363 3300049585 Bacteria 2210
110 Ga0501069_0414884 3300049585 Bacteria 798
111 Ga0501070_0578959 3300049586 Bacteria 896
112 Ga0501070_1316042 3300049586 Bacteria 551
113 Ga0501071_0646915 3300049587 Bacteria 813
114 Ga0501071_1069877 3300049587 Bacteria 623
115 Ga0501072_0222057 3300049588 Bacteria 1506
116 Ga0501072_0384013 3300049588 Bacteria 1114
117 Ga0501072_1581318 3300049588 Bacteria 505
118 Ga0501074_0356173 3300049590 Bacteria 1039
119 Ga0501074_0494102 3300049590 Bacteria 867
120 Ga0501075_0207681 3300049591 Bacteria 1494
121 Ga0501075_0441293 3300049591 Bacteria 993
122 Ga0501076_0881731 3300049592 Bacteria 738
123 Ga0501079_1029820 3300049741 Bacteria 648
124 Ga0501080_1099233 3300049742 Bacteria 686
125 Ga0501080_1513673 3300049742 Bacteria 570
126 Ga0501035_0147632 3300049822 Bacteria 2042
127 Ga0501044_1476133 3300049823 Bacteria 545
128 Ga0501045_0017509 3300049824 Bacteria 5088
129 Ga0501045_0405778 3300049824 Bacteria 1014
130 nmdc:mga03n38_42326_c1 3300050490 Bacteria 1990
131 nmdc:mga03n38_66053_c1 3300050490 Bacteria 1660
132 nmdc:mga00v17_170502_c1 3300050491 Bacteria 1403
133 nmdc:mga00v17_49693_c1 3300050491 Bacteria 2545
134 nmdc:mga00v17_595772_c1 3300050491 Bacteria 713
135 nmdc:mga0yw44_1169104_c1 3300050492 Bacteria 519
136 nmdc:mga0yw44_1244585_c1 3300050492 Bacteria 502
137 nmdc:mga0yw44_180587_c1 3300050492 Bacteria 1389
138 nmdc:mga0yw44_377621_c1 3300050492 Bacteria 957
139 nmdc:mga0yw44_7948_c1 3300050492 Bacteria 5256
140 nmdc:mga07m45_49461_c1 3300050496 Bacteria 1056
141 nmdc:mga08y16_188408_c1 3300050511 Bacteria 2140
142 Ga0500554_148121 3300053102 Bacteria 793
143 Ga0501084_0187603 3300054114 Bacteria 1745
144 Ga0501084_0733033 3300054114 Bacteria 833
145 Ga0501082_0280094 3300060353 Bacteria 1451
146 Ga0501082_0514001 3300060353 Bacteria 1047
147 Ga0530510_0127929 3300061734 Bacteria 1868
148 2643892882 2643221576 Bacteria 5214352
149 2643962331 2643221590 Bacteria 5214697
150 2644032086 2643221604 Bacteria 5014917
151 2738871161 2738541305 Bacteria 4910150
152 2774395029 2773857762 Bacteria 5971770
153 2809194139 2808606439 Bacteria 5952208
154 2812334883 2811994874 Bacteria 5367947
155 2812348869 2811994878 Bacteria 5992952
156 2891973366 2891968417 Bacteria 5821697
157 Ga0466972_0315974
158 JGI24739J22299_10066372
159 Ga0070683_100207885
160 Ga0070660_100578574
161 Ga0070700_101768215
162 Ga0070678_100690278
163 Ga0070684_100311248
164 Ga0068857_100531698
165 Ga0068854_101000919
166 Ga0068852_101150034
167 Ga0081539_10077905
168 Ga0075365_10043816
169 Ga0075365_10176050
170 Ga0075365_10328821
171 Ga0075363_100294538
172 Ga0075364_10439089
173 Ga0075364_10729964
174 Ga0075362_10218105
175 Ga0075370_10014226
176 Ga0075428_101237934
177 Ga0111539_10228442
178 Ga0105243_12684845
179 Ga0105242_12423427
180 Ga0105248_10952803
181 Ga0163161_10314202
182 Ga0207643_10192065
183 Ga0207661_10221981
184 Ga0207651_10385988
185 Ga0207712_11422076
186 Ga0207668_10079776
187 Ga0207640_11870569
188 Ga0207708_10144284
189 Ga0207698_10522120
190 Ga0268264_11362481
191 Ga0314311_1066223
192 Ga0316181_1188129
193 Ga0307408_101995824
194 Ga0307413_10032789
195 Ga0307410_10286471
196 Ga0307410_10412948
197 Ga0307410_10499554
198 Ga0307406_10924711
199 Ga0307407_10604537
200 Ga0307407_10901522
201 Ga0307412_10493583
202 Ga0307412_11715699
203 Ga0307409_100042155
204 Ga0307411_10401935
205 Ga0307415_100182186
206 Ga0395899_0535741
207 Ga0395900_0025824
208 Ga0395900_0108326
209 Ga0395900_1683581
210 Ga0395898_0300636
211 Ga0395905_0102841
212 Ga0395905_0379696
213 Ga0395901_0006072
214 Ga0395901_0329326
215 Ga0439438_111631
216 Ga0451839_1062649
217 Ga0451841_1425217
218 Ga0451853_0462131
219 Ga0439433_0196216
220 Ga0466969_0317099
221 Ga0466972_0599882
222 Ga0466965_0421884
223 Ga0466961_0047227
224 Ga0466963_0665296
225 Ga0466964_0631526
226 Ga0466970_0004651
227 Ga0466970_0013704
228 Ga0466970_0128256
229 Ga0466970_0205431
230 Ga0466970_0489121
231 Ga0466957_0064598
232 Ga0466957_0075301
233 Ga0466957_0259518
234 Ga0466960_0006134
235 Ga0466960_0077102
236 Ga0466960_0140549
237 Ga0466960_0622225
238 Ga0466959_0109769
239 Ga0466967_1012826
240 Ga0466967_1062360
241 Ga0466967_2555157
242 Ga0496104_1095288
243 Ga0496105_0420636
244 Ga0496117_0539136
245 Ga0501031_0029106
246 Ga0501031_0131059
247 Ga0501031_0396195
248 Ga0501032_0467706
249 Ga0501032_0962334
250 Ga0501033_0646608
251 Ga0501034_0523941
252 Ga0501036_0221294
253 Ga0501037_0849067
254 Ga0501038_0090087
255 Ga0501039_0015347
256 Ga0501040_0253280
257 Ga0501040_0493159
258 Ga0501040_0649756
259 Ga0501041_0639676
260 Ga0501042_0038519
261 Ga0501042_0044985
262 Ga0501043_0627769
263 Ga0501048_0091467
264 Ga0501067_0396399
265 Ga0501069_0055363
266 Ga0501069_0414884
267 Ga0501070_0578959
268 Ga0501070_1316042
269 Ga0501071_0646915
270 Ga0501071_1069877
271 Ga0501072_0222057
272 Ga0501072_0384013
273 Ga0501072_1581318
274 Ga0501074_0356173
275 Ga0501074_0494102
276 Ga0501075_0207681
277 Ga0501075_0441293
278 Ga0501076_0881731
279 Ga0501079_1029820
280 Ga0501080_1099233
281 Ga0501080_1513673
282 Ga0501035_0147632
283 Ga0501044_1476133
284 Ga0501045_0017509
285 Ga0501045_0405778
286 nmdc:mga03n38_42326_c1
287 nmdc:mga03n38_66053_c1
288 nmdc:mga00v17_170502_c1
289 nmdc:mga00v17_49693_c1
290 nmdc:mga00v17_595772_c1
291 nmdc:mga0yw44_1169104_c1
292 nmdc:mga0yw44_1244585_c1
293 nmdc:mga0yw44_180587_c1
294 nmdc:mga0yw44_377621_c1
295 nmdc:mga0yw44_7948_c1
296 nmdc:mga07m45_49461_c1
297 nmdc:mga08y16_188408_c1
298 Ga0500554_148121
299 Ga0501084_0187603
300 Ga0501084_0733033
301 Ga0501082_0280094
302 Ga0501082_0514001
303 Ga0530510_0127929
304 2643892882
305 2643962331
306 2644032086
307 2738871161
308 2774395029
309 2809194139
310 2812334883
311 2812348869
312 2891973366

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05768

Glrx-like

Glutaredoxin-like domain (DUF836)

8

85

0.98

PF00462

Glutaredoxin

Glutaredoxin

9

70

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wjk-assembly1.cif.gz_A solution structure of hypothetical protein c330018d20rik from mus musculus 0.8586 2 79
1ttz-assembly1.cif.gz_A x-ray structure of northeast structural genomics target protein xcr50 from x. campestris 0.8475 5 80
1wjk-assembly1.cif.gz_A solution structure of hypothetical protein c330018d20rik from mus musculus 0.8294 2 79
2fgx-assembly1.cif.gz_A solution nmr structure of protein ne2328 from nitrosomonas europaea. northeast structural genomics consortium target net3. 0.8246 1 75
1xpv-assembly1.cif.gz_A solution structure of northeast structural genomics target protein xcr50 from x. campestris 0.8184 4 80
ID Description Score Start End Superfamily
af_Q54N68_13_94_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9101 5 79 3.40.30.10
af_P9WLE7_3_196_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9097 5 38 3.40.30.10
af_P9WKS9_1_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9061 1 75 3.40.30.10
af_Q05530_21_110_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8884 5 79 3.40.30.10
af_Q9CWB7_29_106_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8858 5 79 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4Q9KHH1-F1-model_v4 Glutaredoxin family protein 1.003 6 77
AF-A0A7V9MBI0-F1-model_v4 Glutaredoxin family protein 1.001 3 77
AF-A0A7Z0D9N7-F1-model_v4 Glutaredoxin 0.9971 2 77
AF-A0A7X7JXN6-F1-model_v4 Glutaredoxin family protein 0.9971 8 76
AF-A0A4S8N9D2-F1-model_v4 Glutaredoxin family protein 0.9967 1 79

Map