F225333

General Info

Members Datasets Scaffolds Average Seq Length
156 104 312 297

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0121438|Ga0395900_0121438_1440_2381
Length 313
Sequence VTARERQPFPLVPRWRVTGLPFGEQRSVRRGPGSDVAGSRRYVPGDPVSAIDWYASARLSAARGREEFIVREHYEDEAPHVVVFCDRRPSMGLYDDSLPWLSKPAAAAAVVDAIVVSTLVARGEVGYLDDSGSKGRRGEPYWLPPXXXRGRWEISDRVEAATAFDAPEDTIERGFQHLLRRRADLPSGSFVFVVSDFLAPPADSTWLRAVGLHWDVVPVVIQDPVWEQSFPELPPVVVPYADARSGRIVDVRLSTAQARERHVAHERRLSELLTGLVQLGLEPVLVGSSEPREIDSLFLAWAERRRRSRRRVR

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
61 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
62 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
63 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
66 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
67 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
68 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
69 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
70 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
71 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
72 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
73 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
74 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
75 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
76 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
77 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
78 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
79 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
80 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
81 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
87 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
88 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
89 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
90 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
96 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
97 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
98 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
103 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
104 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 1.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.05
Rhizosphere 92.95
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0121438 3300037418 Bacteria 2680
2 Ga0070658_10004068 3300005327 Bacteria 11986
3 Ga0070658_10013041 3300005327 Bacteria 6670
4 Ga0070658_10141248 3300005327 Bacteria 2012
5 Ga0070683_100179117 3300005329 Bacteria 2012
6 Ga0070660_100003575 3300005339 Bacteria 10732
7 Ga0070660_100009798 3300005339 Bacteria 6752
8 Ga0070660_100013140 3300005339 Bacteria 5932
9 Ga0070661_100010079 3300005344 Bacteria 6562
10 Ga0070661_100073302 3300005344 Bacteria 2521
11 Ga0070675_100071551 3300005354 Bacteria 2877
12 Ga0070674_100052391 3300005356 Bacteria 2815
13 Ga0070659_100066967 3300005366 Bacteria 2847
14 Ga0070659_100473995 3300005366 Bacteria 1064
15 Ga0070714_100042563 3300005435 Bacteria 3838
16 Ga0070713_100370160 3300005436 Unclassified 1333
17 Ga0070708_100100702 3300005445 Bacteria 2645
18 Ga0070681_10083630 3300005458 Bacteria 3145
19 Ga0070681_10095528 3300005458 Bacteria 2921
20 Ga0070681_10473689 3300005458 Bacteria 1165
21 Ga0070707_100087637 3300005468 Bacteria 3011
22 Ga0070707_100189069 3300005468 Bacteria 2008
23 Ga0070707_100343867 3300005468 Bacteria 1449
24 Ga0070698_100032419 3300005471 Bacteria 5412
25 Ga0070679_100021933 3300005530 Bacteria 6237
26 Ga0070679_100049925 3300005530 Bacteria 4167
27 Ga0070679_100100872 3300005530 Bacteria 2873
28 Ga0070696_100288866 3300005546 Unclassified 1252
29 Ga0068855_100052257 3300005563 Bacteria 4811
30 Ga0068852_100065112 3300005616 Bacteria 3179
31 Ga0081539_10001584 3300005985 Bacteria 37596
32 Ga0075434_100079043 3300006871 Bacteria 3286
33 Ga0075435_100069250 3300007076 Bacteria 2876
34 Ga0105240_10055587 3300009093 Bacteria 4955
35 Ga0105240_10133048 3300009093 Bacteria 2980
36 Ga0105245_10406710 3300009098 Bacteria 1361
37 Ga0114129_10076028 3300009147 Bacteria 4675
38 Ga0157373_10134235 3300013100 Bacteria 1740
39 Ga0157370_10012734 3300013104 Bacteria 8703
40 Ga0157370_10037160 3300013104 Bacteria 4722
41 Ga0157369_10007635 3300013105 Bacteria 12442
42 Ga0157369_10056611 3300013105 Bacteria 4231
43 Ga0157375_10052584 3300013308 Bacteria 4005
44 Ga0197907_10883672 3300020069 Bacteria 1548
45 Ga0206354_11442302 3300020081 Bacteria 2333
46 Ga0206353_10735198 3300020082 Bacteria 9075
47 Ga0207705_10052598 3300025909 Bacteria 2932
48 Ga0207705_10089642 3300025909 Bacteria 2251
49 Ga0207684_10119200 3300025910 Bacteria 2262
50 Ga0207707_10030680 3300025912 Bacteria 4703
51 Ga0207707_10277332 3300025912 Bacteria 1452
52 Ga0207695_10037890 3300025913 Bacteria 5199
53 Ga0207695_10088659 3300025913 Unclassified 3113
54 Ga0207693_10099838 3300025915 Bacteria 2276
55 Ga0207660_10043020 3300025917 Bacteria 3173
56 Ga0207657_10001416 3300025919 Bacteria 25595
57 Ga0207657_10003768 3300025919 Bacteria 16111
58 Ga0207657_10012584 3300025919 Bacteria 8340
59 Ga0207657_10015075 3300025919 Bacteria 7507
60 Ga0207652_10019251 3300025921 Bacteria 5612
61 Ga0207652_10045425 3300025921 Bacteria 3745
62 Ga0207652_10327384 3300025921 Bacteria 1383
63 Ga0207646_10256509 3300025922 Bacteria 1580
64 Ga0207664_10002750 3300025929 Bacteria 11679
65 Ga0207664_10046249 3300025929 Bacteria 3415
66 Ga0207669_10162783 3300025937 Unclassified 1578
67 Ga0207661_10123640 3300025944 Bacteria 2207
68 Ga0207661_10514222 3300025944 Bacteria 1095
69 Ga0207667_10056343 3300025949 Bacteria 4129
70 Ga0207639_10237313 3300026041 Bacteria 1583
71 Ga0207702_10161577 3300026078 Bacteria 2046
72 Ga0207698_10079137 3300026142 Bacteria 2643
73 Ga0268266_10275916 3300028379 Unclassified 1562
74 Ga0265334_10009153 3300028573 Bacteria 4196
75 Ga0265338_10013167 3300028800 Bacteria 9364
76 Ga0265338_10061519 3300028800 Bacteria 3290
77 Ga0265320_10006020 3300031240 Bacteria 7706
78 Ga0265320_10050851 3300031240 Bacteria 2013
79 Ga0265329_10021444 3300031242 Bacteria 2170
80 Ga0265327_10012582 3300031251 Bacteria 5694
81 Ga0307408_100043801 3300031548 Bacteria 3186
82 Ga0307412_10132129 3300031911 Bacteria 1815
83 Ga0395899_0053851 3300037312 Bacteria 2979
84 Ga0395899_0140250 3300037312 Bacteria 1720
85 Ga0395900_0019115 3300037418 Bacteria 6986
86 Ga0395900_0038693 3300037418 Bacteria 4916
87 Ga0395900_0581721 3300037418 Bacteria 1062
88 Ga0395898_0006411 3300037466 Bacteria 12564
89 Ga0395898_0014226 3300037466 Bacteria 8181
90 Ga0395898_0080294 3300037466 Bacteria 3146
91 Ga0395898_0087090 3300037466 Bacteria 3009
92 Ga0395898_0406613 3300037466 Unclassified 1298
93 Ga0395898_0486904 3300037466 Bacteria 1173
94 Ga0395905_0104823 3300037471 Bacteria 2655
95 Ga0395901_0002809 3300038443 Bacteria 17581
96 Ga0395901_0016404 3300038443 Bacteria 7543
97 Ga0395901_0017104 3300038443 Bacteria 7393
98 Ga0395901_0032588 3300038443 Bacteria 5375
99 Ga0395901_0049598 3300038443 Bacteria 4362
100 Ga0466966_0019051 3300044684 Bacteria 4523
101 Ga0466961_0154479 3300044693 Bacteria 1432
102 Ga0466963_0015346 3300044694 Bacteria 4741
103 Ga0466963_0016486 3300044694 Bacteria 4595
104 Ga0466964_0201224 3300044706 Bacteria 956
105 Ga0466967_0040268 3300045976 Bacteria 4022
106 Ga0466967_0060272 3300045976 Bacteria 3362
107 Ga0466967_0061537 3300045976 Bacteria 3331
108 Ga0466967_0073902 3300045976 Bacteria 3060
109 Ga0466967_0149179 3300045976 Bacteria 2184
110 Ga0466967_0604314 3300045976 Bacteria 1083
111 Ga0495653_0141788 3300046463 Bacteria 1689
112 Ga0495605_0080240 3300046474 Unclassified 1528
113 Ga0495639_0041658 3300046475 Bacteria 2069
114 Ga0495664_0129689 3300046477 Bacteria 1526
115 Ga0495616_0166625 3300046513 Bacteria 988
116 Ga0495628_0040213 3300046516 Bacteria 3737
117 Ga0495628_0335292 3300046516 Bacteria 1114
118 Ga0495630_0009545 3300046517 Bacteria 6978
119 Ga0495666_0028377 3300046526 Bacteria 2753
120 Ga0495640_0014143 3300046533 Bacteria 6049
121 Ga0495667_0103409 3300046559 Unclassified 1842
122 Ga0495634_0009461 3300046642 Bacteria 7186
123 Ga0495635_0073920 3300046663 Bacteria 2335
124 Ga0495599_0082989 3300046678 Bacteria 2002
125 Ga0495646_0075947 3300046680 Bacteria 1969
126 Ga0495624_0093664 3300046690 Bacteria 1852
127 Ga0495680_0000502 3300047322 Bacteria 44236
128 Ga0495680_0046573 3300047322 Bacteria 3418
129 Ga0495684_0320506 3300047471 Unclassified 1108
130 Ga0496100_0014598 3300048903 Bacteria 4565
131 Ga0496101_0018909 3300048904 Bacteria 4693
132 Ga0496101_0033639 3300048904 Bacteria 3616
133 Ga0496101_0101647 3300048904 Bacteria 2153
134 Ga0496105_0024310 3300048908 Bacteria 4923
135 Ga0496106_0033601 3300048909 Bacteria 3827
136 Ga0496107_0014334 3300048910 Bacteria 5550
137 Ga0496107_0051870 3300048910 Bacteria 2959
138 Ga0496109_0014953 3300048912 Bacteria 6756
139 Ga0496110_0106550 3300048913 Bacteria 2515
140 Ga0496112_0651075 3300048915 Bacteria 983
141 Ga0501031_0122418 3300049568 Bacteria 1699
142 Ga0501032_0167056 3300049569 Unclassified 1444
143 Ga0501036_0293741 3300049572 Unclassified 1359
144 Ga0501041_0081715 3300049577 Bacteria 1990
145 Ga0501046_0300923 3300049580 Bacteria 1171
146 Ga0501069_0107746 3300049585 Unclassified 1585
147 Ga0501072_0488319 3300049588 Bacteria 974
148 Ga0501073_0159095 3300049589 Bacteria 1565
149 Ga0501074_0022857 3300049590 Bacteria 4547
150 Ga0501080_0048003 3300049742 Bacteria 3975
151 Ga0501083_0001359 3300049744 Bacteria 16620
152 nmdc:mga05p37_255752_c1 3300050507 Bacteria 2099
153 nmdc:mga0n895_29695_c1 3300050512 Bacteria 5217
154 nmdc:mga0n895_332806_c1 3300050512 Bacteria 1538
155 Ga0495595_0079164 3300053084 Bacteria 1563
156 Ga0495619_0059971 3300053085 Bacteria 2528
157 Ga0395900_0121438
158 Ga0070658_10004068
159 Ga0070658_10013041
160 Ga0070658_10141248
161 Ga0070683_100179117
162 Ga0070660_100003575
163 Ga0070660_100009798
164 Ga0070660_100013140
165 Ga0070661_100010079
166 Ga0070661_100073302
167 Ga0070675_100071551
168 Ga0070674_100052391
169 Ga0070659_100066967
170 Ga0070659_100473995
171 Ga0070714_100042563
172 Ga0070713_100370160
173 Ga0070708_100100702
174 Ga0070681_10083630
175 Ga0070681_10095528
176 Ga0070681_10473689
177 Ga0070707_100087637
178 Ga0070707_100189069
179 Ga0070707_100343867
180 Ga0070698_100032419
181 Ga0070679_100021933
182 Ga0070679_100049925
183 Ga0070679_100100872
184 Ga0070696_100288866
185 Ga0068855_100052257
186 Ga0068852_100065112
187 Ga0081539_10001584
188 Ga0075434_100079043
189 Ga0075435_100069250
190 Ga0105240_10055587
191 Ga0105240_10133048
192 Ga0105245_10406710
193 Ga0114129_10076028
194 Ga0157373_10134235
195 Ga0157370_10012734
196 Ga0157370_10037160
197 Ga0157369_10007635
198 Ga0157369_10056611
199 Ga0157375_10052584
200 Ga0197907_10883672
201 Ga0206354_11442302
202 Ga0206353_10735198
203 Ga0207705_10052598
204 Ga0207705_10089642
205 Ga0207684_10119200
206 Ga0207707_10030680
207 Ga0207707_10277332
208 Ga0207695_10037890
209 Ga0207695_10088659
210 Ga0207693_10099838
211 Ga0207660_10043020
212 Ga0207657_10001416
213 Ga0207657_10003768
214 Ga0207657_10012584
215 Ga0207657_10015075
216 Ga0207652_10019251
217 Ga0207652_10045425
218 Ga0207652_10327384
219 Ga0207646_10256509
220 Ga0207664_10002750
221 Ga0207664_10046249
222 Ga0207669_10162783
223 Ga0207661_10123640
224 Ga0207661_10514222
225 Ga0207667_10056343
226 Ga0207639_10237313
227 Ga0207702_10161577
228 Ga0207698_10079137
229 Ga0268266_10275916
230 Ga0265334_10009153
231 Ga0265338_10013167
232 Ga0265338_10061519
233 Ga0265320_10006020
234 Ga0265320_10050851
235 Ga0265329_10021444
236 Ga0265327_10012582
237 Ga0307408_100043801
238 Ga0307412_10132129
239 Ga0395899_0053851
240 Ga0395899_0140250
241 Ga0395900_0019115
242 Ga0395900_0038693
243 Ga0395900_0581721
244 Ga0395898_0006411
245 Ga0395898_0014226
246 Ga0395898_0080294
247 Ga0395898_0087090
248 Ga0395898_0406613
249 Ga0395898_0486904
250 Ga0395905_0104823
251 Ga0395901_0002809
252 Ga0395901_0016404
253 Ga0395901_0017104
254 Ga0395901_0032588
255 Ga0395901_0049598
256 Ga0466966_0019051
257 Ga0466961_0154479
258 Ga0466963_0015346
259 Ga0466963_0016486
260 Ga0466964_0201224
261 Ga0466967_0040268
262 Ga0466967_0060272
263 Ga0466967_0061537
264 Ga0466967_0073902
265 Ga0466967_0149179
266 Ga0466967_0604314
267 Ga0495653_0141788
268 Ga0495605_0080240
269 Ga0495639_0041658
270 Ga0495664_0129689
271 Ga0495616_0166625
272 Ga0495628_0040213
273 Ga0495628_0335292
274 Ga0495630_0009545
275 Ga0495666_0028377
276 Ga0495640_0014143
277 Ga0495667_0103409
278 Ga0495634_0009461
279 Ga0495635_0073920
280 Ga0495599_0082989
281 Ga0495646_0075947
282 Ga0495624_0093664
283 Ga0495680_0000502
284 Ga0495680_0046573
285 Ga0495684_0320506
286 Ga0496100_0014598
287 Ga0496101_0018909
288 Ga0496101_0033639
289 Ga0496101_0101647
290 Ga0496105_0024310
291 Ga0496106_0033601
292 Ga0496107_0014334
293 Ga0496107_0051870
294 Ga0496109_0014953
295 Ga0496110_0106550
296 Ga0496112_0651075
297 Ga0501031_0122418
298 Ga0501032_0167056
299 Ga0501036_0293741
300 Ga0501041_0081715
301 Ga0501046_0300923
302 Ga0501069_0107746
303 Ga0501072_0488319
304 Ga0501073_0159095
305 Ga0501074_0022857
306 Ga0501080_0048003
307 Ga0501083_0001359
308 nmdc:mga05p37_255752_c1
309 nmdc:mga0n895_29695_c1
310 nmdc:mga0n895_332806_c1
311 Ga0495595_0079164
312 Ga0495619_0059971

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01882

DUF58

Protein of unknown function DUF58

33

127

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dki-assembly1.cif.gz_B 2.1 a x-ray structure of cysm (rv1336) from mycobacterium tuberculosis an o-phosphoserine dependent cysteine synthase 0.6472 152 270
3tfx-assembly1.cif.gz_B crystal structure of orotidine 5'-phosphate decarboxylase from lactobacillus acidophilus 0.6456 153 200
4le2-assembly3.cif.gz_B-2 crystal structure of the unphosphorylated receiver domain of desr in the active state 0.6161 149 197
8fzv-assembly1.cif.gz_A the von willebrand factor a domain of human capillary morphogenesis gene ii, flexibly fused to the 1tel crystallization chaperone, ala-ala linker variant, expressed with sumo tag 0.6127 79 200
3uqe-assembly1.cif.gz_A-2 crystal structure of the phosphofructokinase-2 mutant y23d from escherichia coli 0.6054 149 199
ID Description Score Start End Superfamily
af_Q22579_577_771_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7927 167 198 3.40.50.410
af_Q0ITF8_4_186_3.40.50.200 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain 0.6811 142 196 3.40.50.200
af_A0A0G2L8G8_1_198_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.664 130 199 3.40.50.410
2vcyB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6599 162 201 3.40.50.720
af_P06773_157_310_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.6387 150 200 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A7W0UBQ9-F1-model_v4 DUF58 domain-containing protein 0.861 119 289
AF-A0A7W0UBQ9-F1-model_v4 DUF58 domain-containing protein 0.856 119 289
AF-A0A7Y5X0B2-F1-model_v4 DUF58 domain-containing protein 0.8506 190 289
AF-A0A7V8XNA0-F1-model_v4 DUF58 domain-containing protein 0.8284 199 288
AF-A0A7Y5X0B2-F1-model_v4 DUF58 domain-containing protein 0.821 190 289

Map