F225310

General Info

Members Datasets Scaffolds Average Seq Length
156 91 312 441

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0040573|Ga0373937_0040573_346_1776
Length 476
Sequence MLDSELNCPLSPLAASFAPDMQQVNLGMIGGGTVGSGVFHALQLNGGLMASRIGVRIRVAKIAVKAFDEPRPYAITPELMTTDWQSVVNDPQVHIVTELVGGTGLARTMTLAALKLGKPVITANKALLSAHGEELFAAANQYGTNLYYEASVCGGIPIIKSLREGFVGNRINQLYGIVNGTCNYILTRMKLEGADFGDVLKDAQAQGYAEAEPSLDVDGLDAQHKIGILASLAHGFWVDPNQIYVEGIRHITRADIQFAKQLGYTIKLLGIIKTAGDSRAVAGTPKGNRLSKSKIVIRKTHGIQVSVYPTLVPDAHVLANVNHVFNAVYVRGDVVGDTLFYGRGAGKDATASAVLSDVADAALDLKFGTKHRIPPFVAHELNGVVTPIDEVISRYFVRLDVVDVPGTLAKIARIFGDAKIGISSVIQPEGHEGASVPLILMLHDAPNGAVSKALKKIGSLKVVRGAPVMIRVESFD

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
30 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
31 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
32 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
33 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
34 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
35 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
36 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
37 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
38 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
39 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
40 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
41 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
42 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
43 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
44 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
45 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
46 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
47 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
48 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
49 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
50 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
51 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
52 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
53 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
54 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
55 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
56 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
57 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
61 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
64 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
65 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
66 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
67 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
68 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
69 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
70 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
71 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
72 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
73 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
74 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
75 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
76 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
77 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
78 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
79 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
80 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
81 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
82 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
90 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
91 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.28
Rhizosphere 98.72
Stem 0
Stem Tuber 0
Unclassified 5.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0040573 3300036401 Bacteria 4243
2 Ga0070683_100148677 3300005329 Bacteria 2221
3 Ga0070690_100006723 3300005330 Bacteria 6534
4 Ga0070689_100005144 3300005340 Bacteria 8897
5 Ga0070691_10035369 3300005341 Unclassified 2352
6 Ga0070688_100003632 3300005365 Bacteria 7964
7 Ga0070688_100031364 3300005365 Unclassified 3197
8 Ga0070714_100019440 3300005435 Bacteria 5535
9 Ga0070711_100009638 3300005439 Bacteria 5952
10 Ga0070686_100000996 3300005544 Bacteria 16352
11 Ga0068855_100020300 3300005563 Bacteria 7971
12 Ga0068855_100053308 3300005563 Bacteria 4759
13 Ga0068855_100075757 3300005563 Bacteria 3906
14 Ga0068855_100079510 3300005563 Bacteria 3802
15 Ga0068857_100007459 3300005577 Bacteria 9413
16 Ga0068856_100001086 3300005614 Bacteria 28668
17 Ga0068856_100132694 3300005614 Bacteria 2495
18 Ga0068863_100040184 3300005841 Bacteria 4448
19 Ga0068858_100053799 3300005842 Bacteria 3723
20 Ga0068860_100015297 3300005843 Bacteria 7494
21 Ga0075428_100028542 3300006844 Bacteria 6173
22 Ga0075431_100008626 3300006847 Bacteria 10208
23 Ga0075431_100293365 3300006847 Unclassified 1644
24 Ga0105240_10007599 3300009093 Bacteria 15703
25 Ga0105242_10065380 3300009176 Bacteria 3000
26 Ga0105242_10245615 3300009176 Bacteria 1611
27 Ga0105238_10035877 3300009551 Bacteria 5041
28 Ga0207694_10019196 3300025924 Bacteria 5167
29 Ga0207664_10016326 3300025929 Bacteria 5416
30 Ga0207686_10115290 3300025934 Bacteria 1819
31 Ga0207686_10121439 3300025934 Bacteria 1779
32 Ga0207670_10004550 3300025936 Bacteria 7489
33 Ga0207670_10018063 3300025936 Bacteria 4277
34 Ga0207670_10069015 3300025936 Unclassified 2437
35 Ga0207667_10030644 3300025949 Bacteria 5816
36 Ga0207703_10103459 3300026035 Bacteria 2418
37 Ga0207702_10002020 3300026078 Bacteria 19660
38 Ga0207702_10096783 3300026078 Bacteria 2596
39 Ga0207674_10009445 3300026116 Bacteria 11144
40 Ga0265337_1000169 3300028556 Bacteria 34043
41 Ga0265337_1001957 3300028556 Bacteria 9790
42 Ga0265337_1006618 3300028556 Bacteria 4441
43 Ga0265337_1011959 3300028556 Bacteria 2969
44 Ga0265319_1013529 3300028563 Bacteria 3239
45 Ga0265319_1013754 3300028563 Bacteria 3201
46 Ga0265334_10015477 3300028573 Bacteria 3167
47 Ga0265323_10001442 3300028653 Bacteria 11684
48 Ga0265323_10008567 3300028653 Bacteria 4214
49 Ga0265336_10003457 3300028666 Bacteria 6189
50 Ga0265338_10000111 3300028800 Bacteria 151469
51 Ga0265338_10000607 3300028800 Bacteria 62806
52 Ga0265338_10001091 3300028800 Bacteria 45113
53 Ga0265338_10001881 3300028800 Bacteria 32873
54 Ga0265338_10006249 3300028800 Bacteria 15244
55 Ga0265338_10009116 3300028800 Bacteria 11920
56 Ga0265338_10015896 3300028800 Bacteria 8234
57 Ga0265338_10019568 3300028800 Bacteria 7173
58 Ga0265338_10023195 3300028800 Bacteria 6390
59 Ga0265338_10023840 3300028800 Bacteria 6274
60 Ga0265338_10030521 3300028800 Bacteria 5308
61 Ga0265338_10033861 3300028800 Bacteria 4950
62 Ga0265338_10043152 3300028800 Bacteria 4187
63 Ga0265338_10060895 3300028800 Bacteria 3311
64 Ga0265338_10076429 3300028800 Bacteria 2836
65 Ga0265338_10082254 3300028800 Unclassified 2697
66 Ga0265338_10086792 3300028800 Bacteria 2602
67 Ga0265338_10110006 3300028800 Bacteria 2222
68 Ga0265338_10131213 3300028800 Bacteria 1978
69 Ga0265324_10000426 3300029957 Bacteria 30166
70 Ga0265324_10005805 3300029957 Bacteria 5250
71 Ga0265324_10014227 3300029957 Bacteria 2948
72 Ga0265324_10042414 3300029957 Bacteria 1572
73 Ga0265320_10003914 3300031240 Bacteria 9844
74 Ga0265320_10015048 3300031240 Bacteria 4381
75 Ga0265320_10028376 3300031240 Bacteria 2906
76 Ga0265320_10044767 3300031240 Bacteria 2178
77 Ga0265325_10011099 3300031241 Bacteria 5185
78 Ga0265340_10006189 3300031247 Bacteria 6597
79 Ga0265340_10017089 3300031247 Bacteria 3752
80 Ga0265340_10020745 3300031247 Bacteria 3373
81 Ga0265339_10016796 3300031249 Bacteria 4354
82 Ga0265327_10034167 3300031251 Bacteria 2825
83 Ga0265316_10004360 3300031344 Bacteria 14110
84 Ga0265316_10052259 3300031344 Bacteria 3206
85 Ga0265316_10055449 3300031344 Bacteria 3099
86 Ga0265313_10005874 3300031595 Bacteria 8902
87 Ga0265314_10037054 3300031711 Bacteria 3537
88 Ga0265342_10047109 3300031712 Bacteria 2588
89 Ga0373930_0003373 3300034816 Bacteria 2527
90 Ga0373929_0006380 3300035085 Bacteria 2131
91 Ga0373944_0000418 3300035089 Bacteria 9719
92 Ga0373949_0000365 3300035090 Bacteria 16028
93 Ga0373951_0017191 3300035091 Bacteria 1635
94 Ga0373932_0000001 3300035112 Bacteria 1459067
95 Ga0373954_0004753 3300035118 Bacteria 5854
96 Ga0373954_0008859 3300035118 Bacteria 4427
97 Ga0373956_0000803 3300035119 Bacteria 13060
98 Ga0373962_0000014 3300035242 Bacteria 48831
99 Ga0373931_0000004 3300035691 Bacteria 535140
100 Ga0373935_0011203 3300035692 Bacteria 5383
101 Ga0373935_0255659 3300035692 Bacteria 1227
102 Ga0373927_0009670 3300035695 Bacteria 6465
103 Ga0373927_0018605 3300035695 Bacteria 4562
104 Ga0373947_0001739 3300035725 Bacteria 13317
105 Ga0373947_0047848 3300035725 Bacteria 2564
106 Ga0373937_0005334 3300036401 Bacteria 10991
107 Ga0373925_0000046 3300037068 Bacteria 131256
108 Ga0373925_0000268 3300037068 Bacteria 54347
109 Ga0373925_0003368 3300037068 Bacteria 12398
110 Ga0395905_0042026 3300037471 Bacteria 4289
111 Ga0395905_0130863 3300037471 Bacteria 2360
112 Ga0451577_0006419 3300042876 Bacteria 11735
113 Ga0453684_0017009 3300044712 Bacteria 11297
114 Ga0451576_0053498 3300045051 Bacteria 4229
115 Ga0451576_0476595 3300045051 Bacteria 1311
116 Ga0495592_0000054 3300046454 Bacteria 107373
117 Ga0495639_0108412 3300046475 Bacteria 1316
118 Ga0495662_0005442 3300046476 Bacteria 6376
119 Ga0495664_0126048 3300046477 Bacteria 1549
120 Ga0495628_0000241 3300046516 Bacteria 48162
121 Ga0495628_0082450 3300046516 Bacteria 2498
122 Ga0495628_0109222 3300046516 Bacteria 2129
123 Ga0495630_0000040 3300046517 Bacteria 106232
124 Ga0495630_0004601 3300046517 Bacteria 9671
125 Ga0495630_0027371 3300046517 Bacteria 4229
126 Ga0495630_0063303 3300046517 Bacteria 2778
127 Ga0495666_0005940 3300046526 Bacteria 6154
128 Ga0495652_0053248 3300046529 Bacteria 3450
129 Ga0495586_0000466 3300046535 Bacteria 24211
130 Ga0495586_0002972 3300046535 Bacteria 9136
131 Ga0495645_0013301 3300046543 Bacteria 5817
132 Ga0495622_0094383 3300046557 Unclassified 1373
133 Ga0495634_0000368 3300046642 Bacteria 43985
134 Ga0495634_0092588 3300046642 Bacteria 1961
135 Ga0495635_0121274 3300046663 Bacteria 1783
136 Ga0495599_0043638 3300046678 Bacteria 2814
137 Ga0495613_0001517 3300046689 Bacteria 17654
138 Ga0495624_0013894 3300046690 Bacteria 5481
139 Ga0495624_0143775 3300046690 Bacteria 1460
140 Ga0495680_0001444 3300047322 Bacteria 25623
141 Ga0496106_0053491 3300048909 Bacteria 3049
142 Ga0496115_0031547 3300048918 Bacteria 4176
143 Ga0501031_0000048 3300049568 Bacteria 65739
144 Ga0501031_0039840 3300049568 Bacteria 3067
145 Ga0501032_0005569 3300049569 Bacteria 9338
146 Ga0501033_0001544 3300049570 Bacteria 20334
147 Ga0501033_0040566 3300049570 Unclassified 3475
148 Ga0501043_0050449 3300049579 Bacteria 3271
149 Ga0501047_0330327 3300049581 Bacteria 1363
150 Ga0501035_0010331 3300049822 Bacteria 8659
151 Ga0501035_0015750 3300049822 Bacteria 6978
152 Ga0501044_0000202 3300049823 Bacteria 75472
153 Ga0501044_0007006 3300049823 Bacteria 12405
154 nmdc:mga06r32_152679_c1 3300050510 Unclassified 2289
155 nmdc:mga08y16_34898_c1 3300050511 Bacteria 5284
156 nmdc:mga08x19_54917_c2 3300050514 Bacteria 1536
157 Ga0373937_0040573
158 Ga0070683_100148677
159 Ga0070690_100006723
160 Ga0070689_100005144
161 Ga0070691_10035369
162 Ga0070688_100003632
163 Ga0070688_100031364
164 Ga0070714_100019440
165 Ga0070711_100009638
166 Ga0070686_100000996
167 Ga0068855_100020300
168 Ga0068855_100053308
169 Ga0068855_100075757
170 Ga0068855_100079510
171 Ga0068857_100007459
172 Ga0068856_100001086
173 Ga0068856_100132694
174 Ga0068863_100040184
175 Ga0068858_100053799
176 Ga0068860_100015297
177 Ga0075428_100028542
178 Ga0075431_100008626
179 Ga0075431_100293365
180 Ga0105240_10007599
181 Ga0105242_10065380
182 Ga0105242_10245615
183 Ga0105238_10035877
184 Ga0207694_10019196
185 Ga0207664_10016326
186 Ga0207686_10115290
187 Ga0207686_10121439
188 Ga0207670_10004550
189 Ga0207670_10018063
190 Ga0207670_10069015
191 Ga0207667_10030644
192 Ga0207703_10103459
193 Ga0207702_10002020
194 Ga0207702_10096783
195 Ga0207674_10009445
196 Ga0265337_1000169
197 Ga0265337_1001957
198 Ga0265337_1006618
199 Ga0265337_1011959
200 Ga0265319_1013529
201 Ga0265319_1013754
202 Ga0265334_10015477
203 Ga0265323_10001442
204 Ga0265323_10008567
205 Ga0265336_10003457
206 Ga0265338_10000111
207 Ga0265338_10000607
208 Ga0265338_10001091
209 Ga0265338_10001881
210 Ga0265338_10006249
211 Ga0265338_10009116
212 Ga0265338_10015896
213 Ga0265338_10019568
214 Ga0265338_10023195
215 Ga0265338_10023840
216 Ga0265338_10030521
217 Ga0265338_10033861
218 Ga0265338_10043152
219 Ga0265338_10060895
220 Ga0265338_10076429
221 Ga0265338_10082254
222 Ga0265338_10086792
223 Ga0265338_10110006
224 Ga0265338_10131213
225 Ga0265324_10000426
226 Ga0265324_10005805
227 Ga0265324_10014227
228 Ga0265324_10042414
229 Ga0265320_10003914
230 Ga0265320_10015048
231 Ga0265320_10028376
232 Ga0265320_10044767
233 Ga0265325_10011099
234 Ga0265340_10006189
235 Ga0265340_10017089
236 Ga0265340_10020745
237 Ga0265339_10016796
238 Ga0265327_10034167
239 Ga0265316_10004360
240 Ga0265316_10052259
241 Ga0265316_10055449
242 Ga0265313_10005874
243 Ga0265314_10037054
244 Ga0265342_10047109
245 Ga0373930_0003373
246 Ga0373929_0006380
247 Ga0373944_0000418
248 Ga0373949_0000365
249 Ga0373951_0017191
250 Ga0373932_0000001
251 Ga0373954_0004753
252 Ga0373954_0008859
253 Ga0373956_0000803
254 Ga0373962_0000014
255 Ga0373931_0000004
256 Ga0373935_0011203
257 Ga0373935_0255659
258 Ga0373927_0009670
259 Ga0373927_0018605
260 Ga0373947_0001739
261 Ga0373947_0047848
262 Ga0373937_0005334
263 Ga0373925_0000046
264 Ga0373925_0000268
265 Ga0373925_0003368
266 Ga0395905_0042026
267 Ga0395905_0130863
268 Ga0451577_0006419
269 Ga0453684_0017009
270 Ga0451576_0053498
271 Ga0451576_0476595
272 Ga0495592_0000054
273 Ga0495639_0108412
274 Ga0495662_0005442
275 Ga0495664_0126048
276 Ga0495628_0000241
277 Ga0495628_0082450
278 Ga0495628_0109222
279 Ga0495630_0000040
280 Ga0495630_0004601
281 Ga0495630_0027371
282 Ga0495630_0063303
283 Ga0495666_0005940
284 Ga0495652_0053248
285 Ga0495586_0000466
286 Ga0495586_0002972
287 Ga0495645_0013301
288 Ga0495622_0094383
289 Ga0495634_0000368
290 Ga0495634_0092588
291 Ga0495635_0121274
292 Ga0495599_0043638
293 Ga0495613_0001517
294 Ga0495624_0013894
295 Ga0495624_0143775
296 Ga0495680_0001444
297 Ga0496106_0053491
298 Ga0496115_0031547
299 Ga0501031_0000048
300 Ga0501031_0039840
301 Ga0501032_0005569
302 Ga0501033_0001544
303 Ga0501033_0040566
304 Ga0501043_0050449
305 Ga0501047_0330327
306 Ga0501035_0010331
307 Ga0501035_0015750
308 Ga0501044_0000202
309 Ga0501044_0007006
310 nmdc:mga06r32_152679_c1
311 nmdc:mga08y16_34898_c1
312 nmdc:mga08x19_54917_c2

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00742

Homoserine_dh

Homoserine dehydrogenase

157

359

0.98

PF03447

NAD_binding_3

Homoserine dehydrogenase, NAD binding domain

30

149

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dzs-assembly1.cif.gz_B mycobacterial homoserine dehydrogenase thra in complex with nadp 0.9487 2 453
6dzs-assembly1.cif.gz_B mycobacterial homoserine dehydrogenase thra in complex with nadp 0.9444 2 453
6dzs-assembly2.cif.gz_C mycobacterial homoserine dehydrogenase thra in complex with nadp 0.9413 2 453
6dzs-assembly2.cif.gz_D mycobacterial homoserine dehydrogenase thra in complex with nadp 0.9406 2 453
6dzs-assembly2.cif.gz_C mycobacterial homoserine dehydrogenase thra in complex with nadp 0.9371 2 453
ID Description Score Start End Superfamily
3mtjA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9605 136 321 3.30.360.10
af_Q2FYV4_151_297_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9594 151 320 3.30.360.10
af_P9WPX1_139_304_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9559 137 320 3.30.360.10
af_Q2FYV4_151_297_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.953 151 320 3.30.360.10
3do5A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9504 149 321 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A6L7EGJ1-F1-model_v4 deleted 0.9908 115 245
AF-X1AIM6-F1-model_v4 Homoserine dehydrogenase catalytic domain-containing protein 0.9865 135 248 GO:0004412
GO:0009088
AF-A0A3E2D1D2-F1-model_v4 deleted 0.9861 97 242
AF-A0A3D2HNN9-F1-model_v4 Homoserine dehydrogenase (EC 1.1.1.3) 0.9828 132 326 GO:0004412
GO:0009086
GO:0009088
AF-A0A662D9J3-F1-model_v4 Homoserine dehydrogenase 0.9795 365 452

Map